(data stored in ACNUC7421 zone)

EMBL: AM269964.PE14

AM269964.PE14        Location/Qualifiers
FT   CDS             join(26756..26796,26871..26888,26981..27419,27491..27859)
FT                   /locus_tag="An01g04970"
FT                   /note="Function: human CTNS is a lysosomal cystine
FT                   transporter."
FT                   /note="Function: mutations in human CTNS cause nephropathic
FT                   cystinosis, an autosomal recessive disorder resulting from
FT                   defective lysosomal transport of cystine."
FT                   /note="Localization: human cystinosin-green fluorescent
FT                   protein colocalizes with lysosomal-associated membrane
FT                   protein 2 (LAMP-2) to lysosomes."
FT                   /note="Title: strong similarity to lysosomal cystine
FT                   transporter cystinosin CTNS - Homo sapiens"
FT                   /note="lysosome"
FT                   /note="See PMID 9537412"
FT                   /note="See PMID 10673275"
FT                   /note="See PMID 11150305"
FT                   /db_xref="GOA:A2Q8N4"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N4"
FT                   /inference="profile:PFAM:PF04193"
FT                   /inference="similar to AA sequence:UniProtKB:AF168787.2"
FT                   /protein_id="CAK37031.1"
FT                   /translation="MATQLEIFVRALSRLLGWIYTFCWSASFYPQPINNFRRRSTTGLA
FT                   IDFPTINVLGFVCYTIYTSAFLYSPVIRHQYAARHPLAEDPTVRFNDFAFALHAVVLSF
FT                   ITYTQFWPFIWGFKVSRHQKVSKPVAGLFWGSIVGVTIVIFIVLGQSPNNGYDPYSWAW
FT                   IDVIYALSYVKLVITIVKYVPQAWVNYKRKSTYGWSIGQILFDLSGGVLSLAQLLLDSS
FT                   FQDDWSGVTGNPIKFLLSNVTIFFDLIFVVQHYILYRDAVDDSGKDRNPSDRTPLLSVS
FT                   DGQPGRS"
     MATQLEIFVR ALSRLLGWIY TFCWSASFYP QPINNFRRRS TTGLAIDFPT INVLGFVCYT        60
     IYTSAFLYSP VIRHQYAARH PLAEDPTVRF NDFAFALHAV VLSFITYTQF WPFIWGFKVS       120
     RHQKVSKPVA GLFWGSIVGV TIVIFIVLGQ SPNNGYDPYS WAWIDVIYAL SYVKLVITIV       180
     KYVPQAWVNY KRKSTYGWSI GQILFDLSGG VLSLAQLLLD SSFQDDWSGV TGNPIKFLLS       240
     NVTIFFDLIF VVQHYILYRD AVDDSGKDRN PSDRTPLLSV SDGQPGRS                    288
//

If you have problems or comments...

PBIL Back to PBIL home page