(data stored in ACNUC7421 zone)

EMBL: AM269964.PE15

AM269964.PE15        Location/Qualifiers
FT   CDS             join(29734..29840,29928..30885)
FT                   /locus_tag="An01g04980"
FT                   /note="Function: Fusarium sp. Tri6 is involved in the
FT                   regulation of enzymes, of the trichothecene toxin
FT                   biosynthesis pathway."
FT                   /note="Remark: the predicted A. niger protein contains a
FT                   zinc-finger-domain in the C-terminus."
FT                   /note="Remark: trichothecenes are sesquiterpenoid
FT                   mycotoxins and act as protein synthesis inhibitors for
FT                   eukaryotic organisms."
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   strong similarity to Tri6 transcription activators of
FT                   several Fusarium species (F. graminearum, F. cerealis, F.
FT                   sporotrichioides)."
FT                   /note="Title: similarity to transcription activator Tri6
FT                   -Fusarium cerealis"
FT                   /note="nucleus"
FT                   /note="See PMID 10635566"
FT                   /db_xref="GOA:A2Q8N5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N5"
FT                   /inference="profile:COGS:COG5048"
FT                   /inference="similar to AA sequence:UniProtKB:AB017496.1"
FT                   /protein_id="CAK37032.1"
FT                   /translation="MHPSPPTCDKPFKEIGFIPLRHPESPRYMNYKYRRSRVSRALLSS
FT                   SEPSAMTSRTTINRAMLMVPGGSSTHSTMSSEVQPYLFPAIAFQQAPLSDARSMSGSVP
FT                   YAFDQAQPLHQRKPDVGTHYFQDQESYTPLFSNQTIPPQSFRPDIESFPPAIPTTDGAY
FT                   FPIDQEEWLAIAVSQSPLNPTNTDYYLPESAPSSFSQSRLTPVTTASLSSATTADLDFE
FT                   LDLDLDLDDLQLQSLSDTSSARSQTRDLTNYGIKNPDGTWRCAYPGCSSHAVFRRGCDL
FT                   RKHYNRHRKHLFCRYEGCPQAVRGGFSSKKDRDRHEAKHNPEIPCEWDGCQRVFSRVDN
FT                   MKDHVRRIHKRRET"
     MHPSPPTCDK PFKEIGFIPL RHPESPRYMN YKYRRSRVSR ALLSSSEPSA MTSRTTINRA        60
     MLMVPGGSST HSTMSSEVQP YLFPAIAFQQ APLSDARSMS GSVPYAFDQA QPLHQRKPDV       120
     GTHYFQDQES YTPLFSNQTI PPQSFRPDIE SFPPAIPTTD GAYFPIDQEE WLAIAVSQSP       180
     LNPTNTDYYL PESAPSSFSQ SRLTPVTTAS LSSATTADLD FELDLDLDLD DLQLQSLSDT       240
     SSARSQTRDL TNYGIKNPDG TWRCAYPGCS SHAVFRRGCD LRKHYNRHRK HLFCRYEGCP       300
     QAVRGGFSSK KDRDRHEAKH NPEIPCEWDG CQRVFSRVDN MKDHVRRIHK RRET             354
//

If you have problems or comments...

PBIL Back to PBIL home page