(data stored in ACNUC7421 zone)

EMBL: AM269964.PE17

AM269964.PE17        Location/Qualifiers
FT   CDS             join(37614..37630,37671..37689,37749..37835,37908..38168)
FT                   /locus_tag="An01g05000"
FT                   /note="Similarity: similarity is between the N-terminal
FT                   regions of the predicted A. niger protein and the
FT                   polyguluronate lyase gene of Corynebacterium sp. (aa
FT                   7-67)."
FT                   /note="Title: weak similarity to polyguluronate lyase alyPG
FT                   - Corynebacterium sp."
FT                   /note="See PMID 9491925"
FT                   /db_xref="GOA:A2Q8N7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N7"
FT                   /inference="similar to AA sequence:UniProtKB:AB030481.1"
FT                   /protein_id="CAK37034.1"
FT                   /translation="MGLRAKPGNLLKLSDRSSLLLIGQSVKPSNHPILDSFRLRPWFGL
FT                   VCVGTLVSIRALPSTVNPNGSGARLKEGPLPFPYQSGKGVSSWFEPDVVEITSRTGSKA
FT                   PSCLLLFVRLPRWNDILIHLKFG"
     MGLRAKPGNL LKLSDRSSLL LIGQSVKPSN HPILDSFRLR PWFGLVCVGT LVSIRALPST        60
     VNPNGSGARL KEGPLPFPYQ SGKGVSSWFE PDVVEITSRT GSKAPSCLLL FVRLPRWNDI       120
     LIHLKFG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page