(data stored in ACNUC7421 zone)

EMBL: AM269964.PE2

AM269964.PE2         Location/Qualifiers
FT   CDS             join(1770..1899,2081..2318,2371..2460,2560..2623)
FT                   /locus_tag="An01g04850"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   BAB09566.1 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8M2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M2"
FT                   /protein_id="CAK37019.1"
FT                   /translation="MQQKYDRSHGILRFPLFGIAHQCGRVAFCLFIGCSPGAWPSQPAI
FT                   QSKVLVSSPRRYRPAVILSGGNGWGQLEKLKLTILDYGITSTIRLPSIHQNLALGAICS
FT                   IGYNVAAIGRSRLITLCSIGVGTGKGGNNKLRQMFKTIGSRSSCSHLCRSPPPSIGVSE
FT                   KIFQASIFPA"
     MQQKYDRSHG ILRFPLFGIA HQCGRVAFCL FIGCSPGAWP SQPAIQSKVL VSSPRRYRPA        60
     VILSGGNGWG QLEKLKLTIL DYGITSTIRL PSIHQNLALG AICSIGYNVA AIGRSRLITL       120
     CSIGVGTGKG GNNKLRQMFK TIGSRSSCSH LCRSPPPSIG VSEKIFQASI FPA              173
//

If you have problems or comments...

PBIL Back to PBIL home page