(data stored in ACNUC7421 zone)

EMBL: AM269964.PE21

AM269964.PE21        Location/Qualifiers
FT   CDS             join(43139..43478,43560..43732,43816..43899)
FT                   /locus_tag="An01g05040"
FT                   /EC_number="3.6.1.23"
FT                   /note="Complex: dUTP pyrophosphatases are homotrimeric
FT                   enzymes."
FT                   /note="Function: dUTP pyrophosphatases hydrolyze dUTP to
FT                   dUMP and pyrophosphate, preventing the incorporation of
FT                   uracil into DNA during replication, and are involved in DNA
FT                   replication and DNA repair."
FT                   /note="Title: strong similarity to dUTP pyrophosphatase
FT                   DUT1 - Candida albicans"
FT                   /note="See PMID 7874734"
FT                   /note="See PMID 8223452"
FT                   /db_xref="GOA:A2Q8P1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P1"
FT                   /inference="profile:COGS:COG0717"
FT                   /inference="profile:COGS:COG0756"
FT                   /inference="profile:PFAM:PF00692"
FT                   /inference="similar to AA sequence:PIR:S51498"
FT                   /protein_id="CAK37038.1"
FT                   /translation="MTKETTPPPPTTTTTEPTTNTTHEPPSLPASPLAKRTKPNTTEQS
FT                   TEPSTMGSTSTPLPPLQVKKLTPTGRAPTRGSAFAAGYDMYSAKETVIPAKGKALVDTG
FT                   IAIAVPEGTYGRIAPRSGLASKHFIDTGAGVIDADYRGEVKVLLFNHSDVDFEVKEGDR
FT                   VAQLVLERIYTPEVVVVEELAESVRGAGGFGSTGV"
     MTKETTPPPP TTTTTEPTTN TTHEPPSLPA SPLAKRTKPN TTEQSTEPST MGSTSTPLPP        60
     LQVKKLTPTG RAPTRGSAFA AGYDMYSAKE TVIPAKGKAL VDTGIAIAVP EGTYGRIAPR       120
     SGLASKHFID TGAGVIDADY RGEVKVLLFN HSDVDFEVKE GDRVAQLVLE RIYTPEVVVV       180
     EELAESVRGA GGFGSTGV                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page