(data stored in ACNUC7421 zone)

EMBL: AM269964.PE22

AM269964.PE22        Location/Qualifiers
FT   CDS             complement(join(44146..44773,44824..44941,45001..45213,
FT                   45264..45343,45423..45433,45491..45544))
FT                   /locus_tag="An01g05050"
FT                   /EC_number="2.7.1.35"
FT                   /note="Catalytic activity: pyridoxal kinases convert ATP +
FT                   pyridoxal to ADP + pyridoxal-5-phosphat."
FT                   /note="Function: human PKH is required for the synthesis of
FT                   pyridoxal-5-phosphate (PLP)1, an essential cofactor for
FT                   numerous enzymic reactions of intermediary metabolism, from
FT                   vitaminB6."
FT                   /note="Remark: an alternative name for human PKH is PNK."
FT                   /note="Title: strong similarity to pyridoxal kinase PKH
FT                   -Homo sapiens"
FT                   /note="See PMID 9099727"
FT                   /db_xref="GOA:A2Q8P2"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P2"
FT                   /inference="profile:COGS:COG0351"
FT                   /inference="similar to AA sequence:SWISSPROT:PDXK.HUMAN"
FT                   /protein_id="CAK37039.1"
FT                   /translation="MSADLLVPETRVLAVASHVVYGYVGNKMASAVMQLMGCDVAALNT
FT                   VHFSNHTGYRQFKGTRATAEEITALYEGLTQSNLLDFDVMLSGYAPSAAAVEAVGAIGM
FT                   DLQRKAEKNPGSFFWVLDPVMGDQGRLYVNDDVVPAYKKVIRHADLILPNQFEAEVLSG
FT                   IKITSLATLAEAITALHAIYNIPHVIITSVQIASLSDSPLPNTLTVIGSTTRSDGAPRL
FT                   FRIDVPALDCYFSGTGDMFAALTVARFREAVFNADPTLRNTKSWVSPDNVPATELPLAQ
FT                   STRKVLASMHCVLEKTLEARDAELRAIVPDESEKLLSQEDQQKRAHLRESKAAEVRVVR
FT                   HAQYLREPEVEFQASEWRREDLPAQFR"
     MSADLLVPET RVLAVASHVV YGYVGNKMAS AVMQLMGCDV AALNTVHFSN HTGYRQFKGT        60
     RATAEEITAL YEGLTQSNLL DFDVMLSGYA PSAAAVEAVG AIGMDLQRKA EKNPGSFFWV       120
     LDPVMGDQGR LYVNDDVVPA YKKVIRHADL ILPNQFEAEV LSGIKITSLA TLAEAITALH       180
     AIYNIPHVII TSVQIASLSD SPLPNTLTVI GSTTRSDGAP RLFRIDVPAL DCYFSGTGDM       240
     FAALTVARFR EAVFNADPTL RNTKSWVSPD NVPATELPLA QSTRKVLASM HCVLEKTLEA       300
     RDAELRAIVP DESEKLLSQE DQQKRAHLRE SKAAEVRVVR HAQYLREPEV EFQASEWRRE       360
     DLPAQFR                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page