(data stored in ACNUC7421 zone)

EMBL: AM269964.PE23

AM269964.PE23        Location/Qualifiers
FT   CDS             46392..47492
FT                   /locus_tag="An01g05060"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA66142.1 - Aspergillus nidulans"
FT                   /db_xref="GOA:A2Q8P3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P3"
FT                   /protein_id="CAK37040.1"
FT                   /translation="MVSIYTPRARSARQHSQQQQLSILLCTLLALPSVLGSVLPSTAEI
FT                   SSGEIVNADLSAAHTTTTNTDQPLSLSLSPDIFTTTTTNANDDTSNLTLHPRSTTTNTT
FT                   SISTDTTDTSSSTFPTAFDTSLTNNFTTTTCATFFHNLLSNTTLTSCHAISLLLRDSTS
FT                   FFHALTSAPTTSSILDTACASNLTTCSTALTSLASQLLQSSTCLHDYNAGNQAVVSAYT
FT                   DLITYAPIYRATCLQSPETNNYCFVDAVTNTSNSVDYDVYFVPYGSAIDAAPWPTCNEC
FT                   LQATLNVYKEYASVDGQPLAESYLPTARGVNGVCGSGFADVNVTVGVVKDGVSSGGAGG
FT                   RFGGGSWGVMVVVVVGWSVGWVIGVV"
     MVSIYTPRAR SARQHSQQQQ LSILLCTLLA LPSVLGSVLP STAEISSGEI VNADLSAAHT        60
     TTTNTDQPLS LSLSPDIFTT TTTNANDDTS NLTLHPRSTT TNTTSISTDT TDTSSSTFPT       120
     AFDTSLTNNF TTTTCATFFH NLLSNTTLTS CHAISLLLRD STSFFHALTS APTTSSILDT       180
     ACASNLTTCS TALTSLASQL LQSSTCLHDY NAGNQAVVSA YTDLITYAPI YRATCLQSPE       240
     TNNYCFVDAV TNTSNSVDYD VYFVPYGSAI DAAPWPTCNE CLQATLNVYK EYASVDGQPL       300
     AESYLPTARG VNGVCGSGFA DVNVTVGVVK DGVSSGGAGG RFGGGSWGVM VVVVVGWSVG       360
     WVIGVV                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page