(data stored in ACNUC7421 zone)

EMBL: AM269964.PE24

AM269964.PE24        Location/Qualifiers
FT   CDS             complement(join(47784..49454,49508..49568,49621..50252))
FT                   /locus_tag="An01g05070"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC776.06c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8P4"
FT                   /db_xref="InterPro:IPR012860"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P4"
FT                   /inference="similar to AA sequence:PIR:T40676"
FT                   /protein_id="CAK37041.1"
FT                   /translation="MSISLPYRPADDSTLSLAATTNPSKANGHPRLSPSPSIIHRRTPS
FT                   SSGNSARRRSLGQGPSTLYPRPRRCKSQYPRDSPERHVEYILVASFHIDRGPIMEHQYP
FT                   AAISGDESMLAELMLPDQTHVRSQDWTIFFLHKDTSADADEDDASTGKKKKKKKSRIGD
FT                   AESGDGDSEDVGGSTEEESSDEEEGGEGPPLMYVLNLVNTKQDTSVKRGAVVKAMAICT
FT                   RHSFLHIYKPLLLLALEDYFKNPYPETLASLYDAVNAMDLSLMPRLSLLERLILQASNC
FT                   KDMFIEKFEQMIHQRQVEDGGPFDEEPPSPKRPAAPRYTLPRDTHEFESKIVYNDIPIP
FT                   VKVPTVIWPEVVGDFSLIKLIQIFSTPHAASPQPFPIHPHLTTSGPFTHPIIVLVNAML
FT                   TQKRVIFLGHNRPSGEVAEAVLAACALASGGILRGFTRHAFPYTDLTKIDDLLRVPGFI
FT                   AGVTNPTFANHPEWWDVLCDLPTGRMKISSHIEPAPVTEGLLYFQQQAAMHHHPPPSNN
FT                   ADPSGDNVFMEEVQRSITNRYGENAIRAKWRAYIAKFTRVAAAFEETVYGASNLYVIGP
FT                   NEELSPESPSGLQADPLDPTTLRGHGYVWPDEGSKQRELMASVARIEGWRTTRSYYSFI
FT                   QDIAAMYYPSRPIQKPDLHHHHDRLRALRLPPADAGAIYISFAHAVKDYAGICQLLTVT
FT                   PENQAGLFYLGMGLFHPHQPVREAAVDLLERIAAHPAGRHFWAQLNRFTKLAFFRIKRE
FT                   RDASTQSPASGLGNESFGPQSLVGVALGDSFRRS"
     MSISLPYRPA DDSTLSLAAT TNPSKANGHP RLSPSPSIIH RRTPSSSGNS ARRRSLGQGP        60
     STLYPRPRRC KSQYPRDSPE RHVEYILVAS FHIDRGPIME HQYPAAISGD ESMLAELMLP       120
     DQTHVRSQDW TIFFLHKDTS ADADEDDAST GKKKKKKKSR IGDAESGDGD SEDVGGSTEE       180
     ESSDEEEGGE GPPLMYVLNL VNTKQDTSVK RGAVVKAMAI CTRHSFLHIY KPLLLLALED       240
     YFKNPYPETL ASLYDAVNAM DLSLMPRLSL LERLILQASN CKDMFIEKFE QMIHQRQVED       300
     GGPFDEEPPS PKRPAAPRYT LPRDTHEFES KIVYNDIPIP VKVPTVIWPE VVGDFSLIKL       360
     IQIFSTPHAA SPQPFPIHPH LTTSGPFTHP IIVLVNAMLT QKRVIFLGHN RPSGEVAEAV       420
     LAACALASGG ILRGFTRHAF PYTDLTKIDD LLRVPGFIAG VTNPTFANHP EWWDVLCDLP       480
     TGRMKISSHI EPAPVTEGLL YFQQQAAMHH HPPPSNNADP SGDNVFMEEV QRSITNRYGE       540
     NAIRAKWRAY IAKFTRVAAA FEETVYGASN LYVIGPNEEL SPESPSGLQA DPLDPTTLRG       600
     HGYVWPDEGS KQRELMASVA RIEGWRTTRS YYSFIQDIAA MYYPSRPIQK PDLHHHHDRL       660
     RALRLPPADA GAIYISFAHA VKDYAGICQL LTVTPENQAG LFYLGMGLFH PHQPVREAAV       720
     DLLERIAAHP AGRHFWAQLN RFTKLAFFRI KRERDASTQS PASGLGNESF GPQSLVGVAL       780
     GDSFRRS                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page