(data stored in ACNUC7421 zone)

EMBL: AM269964.PE25

AM269964.PE25        Location/Qualifiers
FT   CDS             join(51118..51120,51179..51653,51735..52135)
FT                   /locus_tag="An01g05080"
FT                   /note="Similarity: similarity is from the C-terminal half
FT                   of the predicted A. niger protein to myosin regulator light
FT                   chain from P. yessoensis, which is 100 aa shorter."
FT                   /note="Title: similarity to myosin regulatory light chain
FT                   -Patinopecten yessoensis"
FT                   /note="cytoskeleton"
FT                   /note="See PMID 6706905"
FT                   /db_xref="GOA:A2Q8P5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P5"
FT                   /inference="profile:COGS:COG5126"
FT                   /inference="profile:PFAM:PF00036"
FT                   /inference="similar to AA sequence:PIR:A28863"
FT                   /protein_id="CAK37042.1"
FT                   /translation="MVTSNAPFRPSPLSFGSPRPSPFRRPSTPNSHPQGRSSTPGSSPG
FT                   RGYTPVQSPSKLKESYTVEEDDGSSPKSKPRSPIAQPRFTREAPPSPTRGANAPDSSPS
FT                   LMEAKATNMMAASSDAAAKLPPAQLREIREAFQVLDRDNDGLVDKDDVADVLTNVDPTA
FT                   LSKFFPLGGPQTMNFPTFLNTLSQLLAPLSSRQELMNALAAFDEDDSGQIDVDELRDAL
FT                   LHTASEDGDHPLSDREINEVLSGFTGRRAFGGKGARAAGGGKRGEVFRYQDFVSGIMGG
FT                   TENGSTNRRDA"
     MVTSNAPFRP SPLSFGSPRP SPFRRPSTPN SHPQGRSSTP GSSPGRGYTP VQSPSKLKES        60
     YTVEEDDGSS PKSKPRSPIA QPRFTREAPP SPTRGANAPD SSPSLMEAKA TNMMAASSDA       120
     AAKLPPAQLR EIREAFQVLD RDNDGLVDKD DVADVLTNVD PTALSKFFPL GGPQTMNFPT       180
     FLNTLSQLLA PLSSRQELMN ALAAFDEDDS GQIDVDELRD ALLHTASEDG DHPLSDREIN       240
     EVLSGFTGRR AFGGKGARAA GGGKRGEVFR YQDFVSGIMG GTENGSTNRR DA               292
//

If you have problems or comments...

PBIL Back to PBIL home page