(data stored in ACNUC7421 zone)

EMBL: AM269964.PE26

AM269964.PE26        Location/Qualifiers
FT   CDS             join(53038..53409,53500..53735,53865..54278,54612..54735)
FT                   /locus_tag="An01g05090"
FT                   /note="Complex: S. pombe cdc16 forms a heterodimer with
FT                   byr4, which then binds spglp."
FT                   /note="Function: S. pombe cdc16 is required for p34cdc2
FT                   kinase activity and septum formation."
FT                   /note="Function: S. pombe cdc16 negatively regulates
FT                   septation via Spglp GTPase and its effector cdc7 kinase."
FT                   /note="Function: S. pombe cdc16 together with byr4 forms a
FT                   two-component GTPase-activating protein (GAP) regulating
FT                   Spglp GTPase."
FT                   /note="Localization: using indirect immunofluorescence byr4
FT                   localises to the spindle pole bodies except during
FT                   mitosis."
FT                   /note="Similarity: S. pombe cdc16 belongs to the
FT                   superfamily of cell cycle arrest proteins BUB2."
FT                   /note="Title: strong similarity to cell division control
FT                   protein cdc16p - Schizosaccharomyces pombe"
FT                   /note="centrosome"
FT                   /note="See PMID 9742395"
FT                   /note="See PMID 11271422"
FT                   /note="See PMID 8334988"
FT                   /db_xref="GOA:A2Q8P6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P6"
FT                   /inference="profile:COGS:COG5210"
FT                   /inference="profile:PFAM:PF00566"
FT                   /inference="similar to AA sequence:PIR:S35315"
FT                   /protein_id="CAK37043.1"
FT                   /translation="MRGLRKIQSHQILSSHPPSSAHPPSGRLSAGAGELAQPPQLDSPV
FT                   RLRSQRRARSNSDASSREAPAIGTQKRSARKTGSGFGVKRSVLETLLRDGPHQGNLQEG
FT                   LQELRYLVLSTRVEADADGMSTYRIYLWLVLLDVSPVPTDEYLSLIHRGRSPAYTKIRN
FT                   DTFRTMATDPLFKRRVTEASLIRLLNAVAWKLHDAKNKYRGITNESAIYVQGMNVLCAP
FT                   FLYAARSEVEAFALFHSFITRECPGYIRGAMDGVHRGLRLVDQCLEIVEPKLAAYLFSK
FT                   GLQAKLYAFPSVLTLCACTPPLPEVLHLWDFLFAYGTHLNILCIVAQLIRMRDTILESP
FT                   NPNKILRSFPPLDAKEIIALTVLIVRKIPEPLYAELIDHAK"
     MRGLRKIQSH QILSSHPPSS AHPPSGRLSA GAGELAQPPQ LDSPVRLRSQ RRARSNSDAS        60
     SREAPAIGTQ KRSARKTGSG FGVKRSVLET LLRDGPHQGN LQEGLQELRY LVLSTRVEAD       120
     ADGMSTYRIY LWLVLLDVSP VPTDEYLSLI HRGRSPAYTK IRNDTFRTMA TDPLFKRRVT       180
     EASLIRLLNA VAWKLHDAKN KYRGITNESA IYVQGMNVLC APFLYAARSE VEAFALFHSF       240
     ITRECPGYIR GAMDGVHRGL RLVDQCLEIV EPKLAAYLFS KGLQAKLYAF PSVLTLCACT       300
     PPLPEVLHLW DFLFAYGTHL NILCIVAQLI RMRDTILESP NPNKILRSFP PLDAKEIIAL       360
     TVLIVRKIPE PLYAELIDHA K                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page