(data stored in ACNUC7421 zone)

EMBL: AM269964.PE27

AM269964.PE27        Location/Qualifiers
FT   CDS             complement(join(55953..56793,56849..57044,57096..57252,
FT                   57310..57390))
FT                   /locus_tag="An01g05100"
FT                   /note="Function: N. sylvestris cp29B exists as complex with
FT                   ribosome-free mRNAs and possibly acts as stabilizing
FT                   factor."
FT                   /note="Localization: N. sylvestris ribonucleoprotein B 29K
FT                   has been identified from a tobacco chloroplast lysate."
FT                   /note="Remark: N. sylvestris ribonucleoprotein B 29K is
FT                   nuclear encoded."
FT                   /note="Similarity: the predicted ORF contains the RNA
FT                   recognition motiv PF00076 (aa 273-314)."
FT                   /note="Title: weak similarity to ribonucleoprotein B cp29B
FT                   - Nicotiana sylvestris"
FT                   /note="See PMID 11038367"
FT                   /note="See PMID 1721701"
FT                   /db_xref="GOA:A2Q8P7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P7"
FT                   /inference="profile:COGS:COG0724"
FT                   /inference="profile:PFAM:PF00076"
FT                   /inference="similar to AA sequence:PIR:S20070"
FT                   /protein_id="CAK37044.1"
FT                   /translation="MPFPPREKGRMAKSGRSEEEFVLFLQGIPAHCRWQELKDLVRQTA
FT                   LHIRQAVVYDDQHGFPTGLGQIIVKNEDEAWRTYHRLSTNGWEGQSLVVTLARTSSPTR
FT                   PIAGPTKSPTCVIPPNYVPGYSTPPRSTQNMAVPPSPISPEPILSASPSCPTYPATDYG
FT                   PMVNPLAMPQQPFMPFPTDPVTQQPISGIPPSPAPLRHSFGDAFAIPVFPAYPFPTMPP
FT                   FPDAPAHGGFSLPGRRAHMSGKASYGYNPAFAPQIYHSGGPGPRSSPRRTIFVQNLSPT
FT                   TTDKLLRAFIEESGATVEQSEVSTDPDTGRCKGFARVTLRTADEAKRVVAQYNGINFMD
FT                   AKIRVKIDRSLHLAYSLTRERHAGSAPSANANSPVAKNQGPYGAGNSPRSSSLSSSTST
FT                   SSKSGDHCGPLVVNGSNTGTKAVAT"
     MPFPPREKGR MAKSGRSEEE FVLFLQGIPA HCRWQELKDL VRQTALHIRQ AVVYDDQHGF        60
     PTGLGQIIVK NEDEAWRTYH RLSTNGWEGQ SLVVTLARTS SPTRPIAGPT KSPTCVIPPN       120
     YVPGYSTPPR STQNMAVPPS PISPEPILSA SPSCPTYPAT DYGPMVNPLA MPQQPFMPFP       180
     TDPVTQQPIS GIPPSPAPLR HSFGDAFAIP VFPAYPFPTM PPFPDAPAHG GFSLPGRRAH       240
     MSGKASYGYN PAFAPQIYHS GGPGPRSSPR RTIFVQNLSP TTTDKLLRAF IEESGATVEQ       300
     SEVSTDPDTG RCKGFARVTL RTADEAKRVV AQYNGINFMD AKIRVKIDRS LHLAYSLTRE       360
     RHAGSAPSAN ANSPVAKNQG PYGAGNSPRS SSLSSSTSTS SKSGDHCGPL VVNGSNTGTK       420
     AVAT                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page