(data stored in ACNUC7421 zone)

EMBL: AM269964.PE28

AM269964.PE28        Location/Qualifiers
FT   CDS             join(57831..57968,58054..58218)
FT                   /locus_tag="An01g05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8P8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P8"
FT                   /protein_id="CAK37045.1"
FT                   /translation="MAKSVEVGAEGAAAATAAGRVRRARIRIAKAVRMSEEMETERTVG
FT                   PGAQLVLESLRGKSGPDAWRRLGWVNLDELAKADGEEKVVVIAVEESRKDGVQAG"
     MAKSVEVGAE GAAAATAAGR VRRARIRIAK AVRMSEEMET ERTVGPGAQL VLESLRGKSG        60
     PDAWRRLGWV NLDELAKADG EEKVVVIAVE ESRKDGVQAG                             100
//

If you have problems or comments...

PBIL Back to PBIL home page