(data stored in ACNUC7421 zone)

EMBL: AM269964.PE30

AM269964.PE30        Location/Qualifiers
FT   CDS             complement(join(60389..60510,60751..60776,60856..60889,
FT                   61060..61156,61250..61471,61564..61699,61904..61944))
FT                   /locus_tag="An01g05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8Q0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8Q0"
FT                   /protein_id="CAK37047.1"
FT                   /translation="MRRDAAIGSMAGVLLLDRPLLWCRQWWVSLISGPWLNSVVGLASF
FT                   HRLVYSLLGVHCAMDWLTVIRWLCAGDSDNNQLDGVTKCKSIMCAHMCVVPYKTSNIAE
FT                   RSARCHGRQTIYPMVTVSAEMSDNPRPSLLRSMVVVGSSELCPEESRAIDGSPNSACLS
FT                   QEVFNSPRTTVLLILVVHATATMGDPTRAAGPWAEGEGEGVPSNHPTKVYGVVWVDRPT
FT                   IEF"
     MRRDAAIGSM AGVLLLDRPL LWCRQWWVSL ISGPWLNSVV GLASFHRLVY SLLGVHCAMD        60
     WLTVIRWLCA GDSDNNQLDG VTKCKSIMCA HMCVVPYKTS NIAERSARCH GRQTIYPMVT       120
     VSAEMSDNPR PSLLRSMVVV GSSELCPEES RAIDGSPNSA CLSQEVFNSP RTTVLLILVV       180
     HATATMGDPT RAAGPWAEGE GEGVPSNHPT KVYGVVWVDR PTIEF                       225
//

If you have problems or comments...

PBIL Back to PBIL home page