(data stored in ACNUC7421 zone)

EMBL: AM286690.ACPD

AM286690.ACPD        Location/Qualifiers
FT   CDS             complement(29799..30395)
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="ABO_0027"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /function="converts holo-acp to apo-acp by hydrolytic
FT                   cleavage of the phosphopantetheine prosthetic group from
FT                   acp. its physiological function is not clear (by
FT                   similarity). holo-[acyl-carrier protein] + h(2)o =
FT                   4'-phosphopantetheine + apo-[acyl-carrier protein]."
FT                   /EC_number="3.1.4.14"
FT                   /note="(acyl carrier protein phosphodiesterase putative)
FT                   identified by sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15475"
FT                   /db_xref="GOA:Q0VTN3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTN3"
FT                   /protein_id="CAL15475.1"
FT                   /translation="MNILVIKSSVFGDNGNSSALVNAQVDALKAKHPQATVRVRDLSTD
FT                   PIPHLDGNRVSAFFTSATQRTDEQQAIDAFSLALIDEIKAADHIVLGLPMYNFGIPSQL
FT                   KSWIDHVARAGITFRYTEKGPQGLLENKPVTVLAARGGIYAGTSNDTVTPYIKLFFGFI
FT                   GITDVEFVFAEGLNMGDDVKEKALAVARSELLAST"
     MNILVIKSSV FGDNGNSSAL VNAQVDALKA KHPQATVRVR DLSTDPIPHL DGNRVSAFFT        60
     SATQRTDEQQ AIDAFSLALI DEIKAADHIV LGLPMYNFGI PSQLKSWIDH VARAGITFRY       120
     TEKGPQGLLE NKPVTVLAAR GGIYAGTSND TVTPYIKLFF GFIGITDVEF VFAEGLNMGD       180
     DVKEKALAVA RSELLAST                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page