(data stored in ACNUC7421 zone)

EMBL: AM286690.ALG44

AM286690.ALG44       Location/Qualifiers
FT   CDS             435590..436726
FT                   /transl_table=11
FT                   /gene="alg44"
FT                   /locus_tag="ABO_0386"
FT                   /product="alginate biosynthesis protein Alg44"
FT                   /EC_number="2.7.7.7"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15834"
FT                   /db_xref="GOA:Q0VSL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSL4"
FT                   /protein_id="CAL15834.1"
FT                   /translation="MEENKVRQVHESQEERQHVRVKLQGSLRLKIQSPVKGIFSVQDVS
FT                   LGGLSFIAGQVSLAPGTLCHGEIVFRLGRANLSMPVSFKVIYQQDENQLVGGQYSVIDQ
FT                   ENTDLLRLLISNHLAGELTELDDVIDNMKRENYTAIRKNNQQGKTRTLRDRVRALFGSV
FT                   LFFVAGLLAFMFVAWKLYQHAFVTRADDAWVSLPAKTVLMPENGYVRLLLPEGETRVEQ
FT                   GQPLLTVSSRLVSRLNDGVVLDSLDAKQIRALVDAAVFEVTLNSPCDCEITELPVRDGE
FT                   FVHKNSVLMKLVDPGGPATITALFDGSAHTLGGAIGDEVTVRYLDGVTDESAIISQLVR
FT                   DEESGLLRMQITGARELPSSSHNQPVNVTVHPAWLPVL"
     MEENKVRQVH ESQEERQHVR VKLQGSLRLK IQSPVKGIFS VQDVSLGGLS FIAGQVSLAP        60
     GTLCHGEIVF RLGRANLSMP VSFKVIYQQD ENQLVGGQYS VIDQENTDLL RLLISNHLAG       120
     ELTELDDVID NMKRENYTAI RKNNQQGKTR TLRDRVRALF GSVLFFVAGL LAFMFVAWKL       180
     YQHAFVTRAD DAWVSLPAKT VLMPENGYVR LLLPEGETRV EQGQPLLTVS SRLVSRLNDG       240
     VVLDSLDAKQ IRALVDAAVF EVTLNSPCDC EITELPVRDG EFVHKNSVLM KLVDPGGPAT       300
     ITALFDGSAH TLGGAIGDEV TVRYLDGVTD ESAIISQLVR DEESGLLRMQ ITGARELPSS       360
     SHNQPVNVTV HPAWLPVL                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page