(data stored in ACNUC7421 zone)

EMBL: AM286690.ALGI

AM286690.ALGI        Location/Qualifiers
FT   CDS             439420..440838
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="ABO_0389"
FT                   /product="Alginate O-acetylation protein AlgI"
FT                   /function="AlgI is involved in acetylation of the alginate
FT                   polymer ."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15837"
FT                   /db_xref="GOA:Q0VSL1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSL1"
FT                   /protein_id="CAL15837.1"
FT                   /translation="MVFSSNLFVFLFLPLFLAAYYITPTRWRNWTILLGSYLFYAWWRP
FT                   DFLLLFVAITLWNYAFALLIQKYRDHPRCFYWLLLGVTGDLAALGYFKYANFGVESIST
FT                   LMLSVGLNPFFLETIILPLGISFYTFQALAYLVDVYRGDAKPTRSFINFAAFISFFPQL
FT                   IAGPILRYRNLERQFEKRTHSMALFSLGASRFLLGFIKKVLIADSIAPVATYLMAAPDP
FT                   GFVDSVFGVVISSLQLYFDFSGYSDMAIGLGMMMGFKFQENFNQPYTCQSVTEFWRRWH
FT                   ITLTQWLRDYLYRPLKRSLGWSVAVATFTTLTLAGLWHGADLSFVLWGASLGGMMVLER
FT                   WIGTVTTLSTPYSLWKNYRTMAFLWFIWPLFLAGNIDDAWRIMSGLLGMNGWGSLHNLS
FT                   LWVSPMTLFFCVVAMFWERASAYYNKRFYLGIDKSNVYQDVSGWRVPILWCGFALAVTR
FT                   LSAESFSPFLYFQF"
     MVFSSNLFVF LFLPLFLAAY YITPTRWRNW TILLGSYLFY AWWRPDFLLL FVAITLWNYA        60
     FALLIQKYRD HPRCFYWLLL GVTGDLAALG YFKYANFGVE SISTLMLSVG LNPFFLETII       120
     LPLGISFYTF QALAYLVDVY RGDAKPTRSF INFAAFISFF PQLIAGPILR YRNLERQFEK       180
     RTHSMALFSL GASRFLLGFI KKVLIADSIA PVATYLMAAP DPGFVDSVFG VVISSLQLYF       240
     DFSGYSDMAI GLGMMMGFKF QENFNQPYTC QSVTEFWRRW HITLTQWLRD YLYRPLKRSL       300
     GWSVAVATFT TLTLAGLWHG ADLSFVLWGA SLGGMMVLER WIGTVTTLST PYSLWKNYRT       360
     MAFLWFIWPL FLAGNIDDAW RIMSGLLGMN GWGSLHNLSL WVSPMTLFFC VVAMFWERAS       420
     AYYNKRFYLG IDKSNVYQDV SGWRVPILWC GFALAVTRLS AESFSPFLYF QF               472
//

If you have problems or comments...

PBIL Back to PBIL home page