(data stored in ACNUC7421 zone)

EMBL: AM286690.ARGB

AM286690.ARGB        Location/Qualifiers
FT   CDS             complement(227397..228296)
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="ABO_0210"
FT                   /product="acetylglutamate kinase"
FT                   /function="ATP + N-acetyl-L-glutamate = ADP +
FT                   N-acetyl-L-glutamate 5-phosphate."
FT                   /EC_number="2.7.2.8"
FT                   /note="(acetylglutamate kinase,
FT                   N-acetyl-L-glutamate-5-phosphotransferase) identified by
FT                   sequence similarity; putative identified by match to
FT                   TIGRFAM protein family HMMTIGR00761; putative InterPro:
FT                   Acetylglutamate kinase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15658"
FT                   /db_xref="GOA:Q0VT62"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT62"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00761"
FT                   /protein_id="CAL15658.1"
FT                   /translation="MDANSAHDTARILIEALPYIQRFAGTTVVIKYGGNAMENEELKNS
FT                   FARDVVMMKQVGIHPVIVHGGGPQIGELLERLGKESKFVQGMRVTDRETMDVVQMVLGG
FT                   LVNKDIVNLIQHNGGQAIGLTGKDGRLIKARKMVLKASDADSPALQASEIIDIGHVGEV
FT                   QGIDTRIIDLLAGSDFIPVIAPIGVDDNGASYNINADLVAGKVAEVLRAEKLILLTNVP
FT                   GLKDKQGQILTGLTTERVNSLIKDGTIYGGMLPKIGCALEAVQNGVHTAHIIDGRVSHA
FT                   VLLEILTDKGIGTLISKD"
     MDANSAHDTA RILIEALPYI QRFAGTTVVI KYGGNAMENE ELKNSFARDV VMMKQVGIHP        60
     VIVHGGGPQI GELLERLGKE SKFVQGMRVT DRETMDVVQM VLGGLVNKDI VNLIQHNGGQ       120
     AIGLTGKDGR LIKARKMVLK ASDADSPALQ ASEIIDIGHV GEVQGIDTRI IDLLAGSDFI       180
     PVIAPIGVDD NGASYNINAD LVAGKVAEVL RAEKLILLTN VPGLKDKQGQ ILTGLTTERV       240
     NSLIKDGTIY GGMLPKIGCA LEAVQNGVHT AHIIDGRVSH AVLLEILTDK GIGTLISKD        299
//

If you have problems or comments...

PBIL Back to PBIL home page