(data stored in ACNUC7421 zone)

EMBL: AM286690.ARGC

AM286690.ARGC        Location/Qualifiers
FT   CDS             395479..396549
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="ABO_0359"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /function="catalyses the NADPH-dependent reduction of
FT                   N-acetyl-gamma-glutamyl phosphate to give the
FT                   N-acetylglutamic semialdehyde"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase active site"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15807"
FT                   /db_xref="GOA:Q0VSP1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP1"
FT                   /protein_id="CAL15807.1"
FT                   /translation="MSSQPAQASAPLKVGVVGGTGYTGVELLRLLVNHPHAELDVITSR
FT                   GEAGVAVADLFPSLRGRTDLVFSEPDAKRLAGCDVVFFATPHNVAMRMMPELMDAGVRV
FT                   VDLSADFRLRDHELWSEWYGEPHACPELLADAVYGLPEVNREAIRDARLVACAGCYPTS
FT                   IQLGYLPLLENGWIKPDQLIANAASGASGGGKSAKVPMLLAEAGESYKAYGASGHRHLP
FT                   EIEQGLADIAGGPVSATFVPHLIPMIRGIHSTLYGQLTASAPPLEEIQAAFEARYADEP
FT                   FVDVMPLGSHPETRFVKGANMCRLALHQPRGESVIVVLSVIDNLVKGASGQAVQAMNIM
FT                   FGLDEGAGLAVVPLAP"
     MSSQPAQASA PLKVGVVGGT GYTGVELLRL LVNHPHAELD VITSRGEAGV AVADLFPSLR        60
     GRTDLVFSEP DAKRLAGCDV VFFATPHNVA MRMMPELMDA GVRVVDLSAD FRLRDHELWS       120
     EWYGEPHACP ELLADAVYGL PEVNREAIRD ARLVACAGCY PTSIQLGYLP LLENGWIKPD       180
     QLIANAASGA SGGGKSAKVP MLLAEAGESY KAYGASGHRH LPEIEQGLAD IAGGPVSATF       240
     VPHLIPMIRG IHSTLYGQLT ASAPPLEEIQ AAFEARYADE PFVDVMPLGS HPETRFVKGA       300
     NMCRLALHQP RGESVIVVLS VIDNLVKGAS GQAVQAMNIM FGLDEGAGLA VVPLAP           356
//

If you have problems or comments...

PBIL Back to PBIL home page