(data stored in ACNUC7421 zone)

EMBL: AM286690.AROE

AM286690.AROE        Location/Qualifiers
FT   CDS             146772..147608
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="ABO_0136"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /function="shikimate + NADP(+) = 5-dehydroshikimate +
FT                   NADPH."
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by sequence similarity; putative
FT                   identified by match to PFAM protein family HMMPF01488 and
FT                   TIGRFAM protein family HMMTIGR00507 InterPro: Shikimate /
FT                   quinate 5-dehydrogenase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15584"
FT                   /db_xref="GOA:Q0VTD6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTD6"
FT                   /inference="protein motif:HMMPFAM:HMMPF01488"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00507"
FT                   /protein_id="CAL15584.1"
FT                   /translation="MSGEKDRADTGLYCVFGNPVSHSRSPEIHHAFAAQHSDPVQYEKR
FT                   EAPLDDFAGAVQAFREAGGLGANVTVPFKEQAFALCDAITERADQAGAVNTLWWDGDQL
FT                   HGDNTDGAGLVKDIRNNQGWTIRKKRVLILGAGGAVRGVLGPILAQEPTLLRIANRTKE
FT                   KAEALAGNVMKGEGPPVLGGGLDNLMGQFDLVINAISAGLHGEMPALPDGLLAEGAVAY
FT                   DMVYGSEPTPFMRWAEQQGAAATADGLGMLVEQAAEAFEIWRGWRPNTAPVMASLR"
     MSGEKDRADT GLYCVFGNPV SHSRSPEIHH AFAAQHSDPV QYEKREAPLD DFAGAVQAFR        60
     EAGGLGANVT VPFKEQAFAL CDAITERADQ AGAVNTLWWD GDQLHGDNTD GAGLVKDIRN       120
     NQGWTIRKKR VLILGAGGAV RGVLGPILAQ EPTLLRIANR TKEKAEALAG NVMKGEGPPV       180
     LGGGLDNLMG QFDLVINAIS AGLHGEMPAL PDGLLAEGAV AYDMVYGSEP TPFMRWAEQQ       240
     GAAATADGLG MLVEQAAEAF EIWRGWRPNT APVMASLR                               278
//

If you have problems or comments...

PBIL Back to PBIL home page