(data stored in ACNUC7421 zone)

EMBL: AM286690.CARA

AM286690.CARA        Location/Qualifiers
FT   CDS             346031..347155
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ABO_0317"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /function="2 ATP + L-glutamine + CO(2) + H(2)O = 2 ADP +
FT                   phosphate + L-glutamate + carbamoyl phosphate."
FT                   /EC_number="6.3.5.5"
FT                   /note="(carbamoyl-phosphate synthase small subunit,
FT                   carbamoyl-phosphate synthetase glutamine chain) identified
FT                   by sequence similarity; putative identified by match to
FT                   PFAM protein family HMMPF00988; putative InterPro:
FT                   Glutamine amidotransferase class-I"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15765"
FT                   /db_xref="GOA:Q0VST3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VST3"
FT                   /inference="protein motif:HMMPFAM:HMMPF00988"
FT                   /protein_id="CAL15765.1"
FT                   /translation="MTVPAILALEDGSIFRGVAIGATGETVGEVVFNTAMTGYQEILTD
FT                   PSYAKQIVTLTYPHIGNTGVTAEDEESSRIWASGLVIRDLAMTVSNWRSEQSLSDYLRD
FT                   RNIVAIADIDTRRLTRILRDKGALNGCILAGESVDEAQALAAAKGFPGLKGMDLAKVVS
FT                   VAEPYSWTESTWDLEQGHTEQGETRFHVVAYDYGVKRNILRMLAERGCKLTVVPAQTPA
FT                   SEVLAMKPDGVFLSNGPGDPEPCDYAISAIQEIVGTGLPVFGICLGHQLLALASGAKSM
FT                   KMATGHHGANHPVKTLADDTVMITSQNHGFAVDIDTLPANLKVTHVSLFDGTLQGIERT
FT                   DVPAFSFQGHPEASPGPRDCAPLFDHFIELMEAK"
     MTVPAILALE DGSIFRGVAI GATGETVGEV VFNTAMTGYQ EILTDPSYAK QIVTLTYPHI        60
     GNTGVTAEDE ESSRIWASGL VIRDLAMTVS NWRSEQSLSD YLRDRNIVAI ADIDTRRLTR       120
     ILRDKGALNG CILAGESVDE AQALAAAKGF PGLKGMDLAK VVSVAEPYSW TESTWDLEQG       180
     HTEQGETRFH VVAYDYGVKR NILRMLAERG CKLTVVPAQT PASEVLAMKP DGVFLSNGPG       240
     DPEPCDYAIS AIQEIVGTGL PVFGICLGHQ LLALASGAKS MKMATGHHGA NHPVKTLADD       300
     TVMITSQNHG FAVDIDTLPA NLKVTHVSLF DGTLQGIERT DVPAFSFQGH PEASPGPRDC       360
     APLFDHFIEL MEAK                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page