(data stored in ACNUC7421 zone)

EMBL: AM286690.CHER

AM286690.CHER        Location/Qualifiers
FT   CDS             complement(113523..114401)
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="ABO_0105"
FT                   /product="Chemotaxis protein methyltransferase"
FT                   /function="Methylase of chemotaxis methyl"
FT                   /EC_number="2.1.1.80"
FT                   /note="(methyltransferase CheR-like) identified by match to
FT                   PFAM protein family HMMPF00515"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15553"
FT                   /db_xref="GOA:Q0VTJ0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTJ0"
FT                   /inference="protein motif:HMMPFAM:HMMPF00515"
FT                   /protein_id="CAL15553.1"
FT                   /translation="MGAAMTDRWSIKRMPTMNAEQFQLWQTLLEDRTGMTLSNERKTFL
FT                   ETSLNMRMRELGIEDYETYYEHLVMGSTQSRVMEWSVLVDRLTVQETSFFRHPGSYALV
FT                   EEFSQRFMAEQPGGASLDVWSVGCSTGEEAYSLAIIINEQFSTSEQKLFYGITATDISL
FT                   PTLAKARKGEYAARRVLQVDPLIRQKYFTPSNNGQTVEITRDLRERICFARLNVLDLST
FT                   APINNMDLIFCQNMLIYFRRWRKRQILNRLAERLALGGILILGPGEVTDWQHPDLERVH
FT                   FADTLAFRRCK"
     MGAAMTDRWS IKRMPTMNAE QFQLWQTLLE DRTGMTLSNE RKTFLETSLN MRMRELGIED        60
     YETYYEHLVM GSTQSRVMEW SVLVDRLTVQ ETSFFRHPGS YALVEEFSQR FMAEQPGGAS       120
     LDVWSVGCST GEEAYSLAII INEQFSTSEQ KLFYGITATD ISLPTLAKAR KGEYAARRVL       180
     QVDPLIRQKY FTPSNNGQTV EITRDLRERI CFARLNVLDL STAPINNMDL IFCQNMLIYF       240
     RRWRKRQILN RLAERLALGG ILILGPGEVT DWQHPDLERV HFADTLAFRR CK               292
//

If you have problems or comments...

PBIL Back to PBIL home page