(data stored in ACNUC7421 zone)

EMBL: AM286690.CHEW

AM286690.CHEW        Location/Qualifiers
FT   CDS             complement(104815..105270)
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="ABO_0102"
FT                   /product="chemotaxis protein, putative"
FT                   /note="(chemotaxis protein, putative), pfam01584, CheW,
FT                   CheW-like domain."
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15550"
FT                   /db_xref="GOA:Q0VTJ3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTJ3"
FT                   /protein_id="CAL15550.1"
FT                   /translation="MAQLPSDISSLLIPMQGRPWLVPNIVVAEVIPLRQPDRPGHGPEW
FT                   LLGWLSWRDQQIPLLSFEKLNESGQVTIGQDARIAVLNTVTSQVPFYAMIVQGIPRLLK
FT                   VSKDDPVEEPMDTGPAETMYIQVGGDLAVIPDLDAIEGAVAGLQKPA"
     MAQLPSDISS LLIPMQGRPW LVPNIVVAEV IPLRQPDRPG HGPEWLLGWL SWRDQQIPLL        60
     SFEKLNESGQ VTIGQDARIA VLNTVTSQVP FYAMIVQGIP RLLKVSKDDP VEEPMDTGPA       120
     ETMYIQVGGD LAVIPDLDAI EGAVAGLQKP A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page