(data stored in ACNUC7421 zone)

EMBL: AM286690.COBS

AM286690.COBS        Location/Qualifiers
FT   CDS             157488..158273
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="ABO_0147"
FT                   /product="Cobalamin 5'-phosphate synthase."
FT                   /function="proposed to catalyze the late steps in
FT                   adenosylcobalamin biosynthesis, which define the nucleotide
FT                   loop assembly pathway."
FT                   /EC_number="6.5.-.-"
FT                   /note="(cobalamin (5-phosphate) synthase) identified by
FT                   sequence similarity; putative InterPro:
FT                   Cobalamin-5-phosphate synthase CobS"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15595"
FT                   /db_xref="GOA:Q0VTC5"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTC5"
FT                   /protein_id="CAL15595.1"
FT                   /translation="MKKHQSHHHAQQRFTHRDWQEEWQAFWLAVGFLTRIPMLVRIDYS
FT                   QTLMNRSSVYFPLVGLLLGALYAGLFVLLDAFWATGICVALILVFHLWITGAFHEDGLA
FT                   DSVDALGGGYTVARRLEIMKDSRIGTYGTVALIMALGLKGLLLAEAKTVWLALLLSPVV
FT                   SRLTPLWLMRYLPYVTDPNTSKSKPVAEGFSTQRLCVATALTVVVAALAGAVIPALLSV
FT                   VVVALLWGGYLWRHLRGYTGDTLGASVVLCELVFLLLWG"
     MKKHQSHHHA QQRFTHRDWQ EEWQAFWLAV GFLTRIPMLV RIDYSQTLMN RSSVYFPLVG        60
     LLLGALYAGL FVLLDAFWAT GICVALILVF HLWITGAFHE DGLADSVDAL GGGYTVARRL       120
     EIMKDSRIGT YGTVALIMAL GLKGLLLAEA KTVWLALLLS PVVSRLTPLW LMRYLPYVTD       180
     PNTSKSKPVA EGFSTQRLCV ATALTVVVAA LAGAVIPALL SVVVVALLWG GYLWRHLRGY       240
     TGDTLGASVV LCELVFLLLW G                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page