(data stored in ACNUC7421 zone)

EMBL: AM286690.CYSE

AM286690.CYSE        Location/Qualifiers
FT   CDS             565557..566324
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="ABO_0514"
FT                   /product="serine acetyltransferase"
FT                   /function="acetyl-CoA + L-serine = CoA +
FT                   O-acetyl-L-serine."
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Bacterial transferase hexapeptide repeat"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15962"
FT                   /db_xref="GOA:Q0VS86"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS86"
FT                   /protein_id="CAL15962.1"
FT                   /translation="MLNQVREDIRSVFHRDPAARNTLEVLLNYPGLHAVLFHRLANGLW
FT                   TRNFKQLARLLSTFSRWLTGIEIHPGAKIGRRFFIDHGMGVVIGETAEIGDDVTLYHGV
FT                   TLGGTSWSKGKRHPTLEDGVVVGAGAKVLGPFTVHKNAKIGSNSVVTKEVPEGATVVGI
FT                   PGRVINHPLTEKEKTRQEMAEKIGFQAYGVSNDMPDPVAEAIHLLLDHMHAVDNKLDRV
FT                   CTNLKKQGIQGCDEKLPELNNEDFEPVNAGGTD"
     MLNQVREDIR SVFHRDPAAR NTLEVLLNYP GLHAVLFHRL ANGLWTRNFK QLARLLSTFS        60
     RWLTGIEIHP GAKIGRRFFI DHGMGVVIGE TAEIGDDVTL YHGVTLGGTS WSKGKRHPTL       120
     EDGVVVGAGA KVLGPFTVHK NAKIGSNSVV TKEVPEGATV VGIPGRVINH PLTEKEKTRQ       180
     EMAEKIGFQA YGVSNDMPDP VAEAIHLLLD HMHAVDNKLD RVCTNLKKQG IQGCDEKLPE       240
     LNNEDFEPVN AGGTD                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page