(data stored in ACNUC7421 zone)

EMBL: AM286690.DEF-1

AM286690.DEF-1       Location/Qualifiers
FT   CDS             complement(142342..142848)
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="ABO_0131"
FT                   /product="peptide deformylase"
FT                   /function="required for the removal of the formyl group at
FT                   the N-terminus of nascent polypeptide chains: converts
FT                   N-formyl-L-methionine to formate + L-methionine"
FT                   /EC_number="3.5.1.88"
FT                   /note="(polypeptide deformylase) identified by match to
FT                   TIGR protein family HMMTIGR00079 InterPro: Formylmethionine
FT                   deformylase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15579"
FT                   /db_xref="GOA:Q0VTE1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTE1"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00079"
FT                   /protein_id="CAL15579.1"
FT                   /translation="MAKLEILEFPDPRLRTVAKPVEKVDDELRKLIDDMFETMYAAPGI
FT                   GLAATQVDVHIQLIVMDLSEDHNKPMVFINPQITPLTEEQAPYEEGCLSVPGFYEKVTR
FT                   PARVRINALDRDGNAFEVEADELLATCIQHEMDHLDGKLFVDYVSRLKRDRIKKKLEKI
FT                   HRQQG"
     MAKLEILEFP DPRLRTVAKP VEKVDDELRK LIDDMFETMY AAPGIGLAAT QVDVHIQLIV        60
     MDLSEDHNKP MVFINPQITP LTEEQAPYEE GCLSVPGFYE KVTRPARVRI NALDRDGNAF       120
     EVEADELLAT CIQHEMDHLD GKLFVDYVSR LKRDRIKKKL EKIHRQQG                    168
//

If you have problems or comments...

PBIL Back to PBIL home page