(data stored in ACNUC7421 zone)

EMBL: AM286690.DNAJ

AM286690.DNAJ        Location/Qualifiers
FT   CDS             343629..344759
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ABO_0315"
FT                   /product="Heat shock protein DnaJ"
FT                   /function="The DnaJ protein functions with the GrpE and
FT                   DnaK proteins to prevent the aggregation of newly
FT                   synthesized proteins and of unfolded proteins that arise as
FT                   a consequence of cell stress."
FT                   /note="(dnaJ protein), (Chaperone protein dnaJ), identified
FT                   by sequencesimilarity; putative InterPro: DnaJ C terminal
FT                   domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15763"
FT                   /db_xref="GOA:Q0VST5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VST5"
FT                   /protein_id="CAL15763.1"
FT                   /translation="MSKRDYYEVLGAAKDASAQDLKKAYRRLAMKYHPDRNPDDKEALA
FT                   KFKEAKEAYEVLADEQKRAAYDQFGHAGVNGQGGGPGAGAGAGGFGDIFGDIFGDIFGG
FT                   AGGGGGRRGPSRGADLRYTLELSLEQAVRGCDEKIRIPTWDSCDVCHGSGAKEGSQPVT
FT                   CTTCGGVGQVRMQQGFFTVQQACPTCKGEGKIIKDPCGNCGGQGRVQNTKTLSVKIPAG
FT                   VDTGDRIRLAGEGEAGVHGAPSGDLYVQVAVREHDIFQRDGDNLYCEVPISFVDATLGG
FT                   ELDVPTLNGKVKLKVPAETQSGKLFRLRGKGVAPVRGGAPGDLLCKVVIETPVKLSSEQ
FT                   KELLRKFQESLESGGNRHNPRKNNWFEGVKRFFDTK"
     MSKRDYYEVL GAAKDASAQD LKKAYRRLAM KYHPDRNPDD KEALAKFKEA KEAYEVLADE        60
     QKRAAYDQFG HAGVNGQGGG PGAGAGAGGF GDIFGDIFGD IFGGAGGGGG RRGPSRGADL       120
     RYTLELSLEQ AVRGCDEKIR IPTWDSCDVC HGSGAKEGSQ PVTCTTCGGV GQVRMQQGFF       180
     TVQQACPTCK GEGKIIKDPC GNCGGQGRVQ NTKTLSVKIP AGVDTGDRIR LAGEGEAGVH       240
     GAPSGDLYVQ VAVREHDIFQ RDGDNLYCEV PISFVDATLG GELDVPTLNG KVKLKVPAET       300
     QSGKLFRLRG KGVAPVRGGA PGDLLCKVVI ETPVKLSSEQ KELLRKFQES LESGGNRHNP       360
     RKNNWFEGVK RFFDTK                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page