(data stored in ACNUC7421 zone)

EMBL: AM286690.DNAK

AM286690.DNAK        Location/Qualifiers
FT   CDS             341602..343527
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ABO_0314"
FT                   /product="Heat shock protein DnaK"
FT                   /function="The DnaK protein functions with the GrpE and
FT                   DnaJ proteins to prevent the aggregation of newly
FT                   synthesized proteins and of unfolded proteins that arise as
FT                   a consequence of cell stress."
FT                   /note="(dnaK protein), (Chaperone protein dnaK), (Heat
FT                   shock protein 70) identified by sequencesimilarity;
FT                   putative InterPro: Heat shock protein hsp70"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15762"
FT                   /db_xref="GOA:Q0VST6"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VST6"
FT                   /protein_id="CAL15762.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVLEGDKAKVIENAEGARTTPSIIAYTDD
FT                   KETLVGQAAKRQAVTNPENTLYAVKRLIGRRFDDKVVQKDIKMVPYKITKADNGDAWVE
FT                   VKGEKMAPPQISAQVLKKMKKTAEDYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGLDKKGGDRTIAVYDLGGGTFDISIIEIAEVDGEHQFEVLATN
FT                   GDTFLGGEDFDLALINFLADQFKADSGIDLGGDPLAMQRLKEAAEKAKIELSSAEQTEV
FT                   NLPYITADSTGPKHLVVKVTRAKLESLVGDLVTRSLEPCKTALADAGVKTADITDVILV
FT                   GGQTRMPMVQKSVTEFFGKEPRKDVNPDEAVAMGAAIQGAVLSGDVTDVLLLDVTPLTL
FT                   GIETMGGVMTPLIEKNTTIPTNASQVFSTADDNQTAVTVHVLQGERKQASQNKSLGQFN
FT                   LEDIPPAPRGMPQIEVTFDIDANGILHVGAKDKATGKEQTIQIKASSGLSDEEIDQMVQ
FT                   DAEAHADEDKKFEELVQTRNQADHLVHATRKTLEEAGDKATDEEKEAITKAVDELEEAA
FT                   KGSDKDDIEAKIKALSEVSAPLAEKMYAEQAQQAQGAAGAEGEQPQAGDDVVDAEFEEV
FT                   DDDKKK"
     MGKIIGIDLG TTNSCVAVLE GDKAKVIENA EGARTTPSII AYTDDKETLV GQAAKRQAVT        60
     NPENTLYAVK RLIGRRFDDK VVQKDIKMVP YKITKADNGD AWVEVKGEKM APPQISAQVL       120
     KKMKKTAEDY LGEAVTEAVI TVPAYFNDSQ RQATKDAGRI AGLDVKRIIN EPTAAALAYG       180
     LDKKGGDRTI AVYDLGGGTF DISIIEIAEV DGEHQFEVLA TNGDTFLGGE DFDLALINFL       240
     ADQFKADSGI DLGGDPLAMQ RLKEAAEKAK IELSSAEQTE VNLPYITADS TGPKHLVVKV       300
     TRAKLESLVG DLVTRSLEPC KTALADAGVK TADITDVILV GGQTRMPMVQ KSVTEFFGKE       360
     PRKDVNPDEA VAMGAAIQGA VLSGDVTDVL LLDVTPLTLG IETMGGVMTP LIEKNTTIPT       420
     NASQVFSTAD DNQTAVTVHV LQGERKQASQ NKSLGQFNLE DIPPAPRGMP QIEVTFDIDA       480
     NGILHVGAKD KATGKEQTIQ IKASSGLSDE EIDQMVQDAE AHADEDKKFE ELVQTRNQAD       540
     HLVHATRKTL EEAGDKATDE EKEAITKAVD ELEEAAKGSD KDDIEAKIKA LSEVSAPLAE       600
     KMYAEQAQQA QGAAGAEGEQ PQAGDDVVDA EFEEVDDDKK K                           641
//

If you have problems or comments...

PBIL Back to PBIL home page