(data stored in ACNUC7421 zone)

EMBL: AM286690.DSBB

AM286690.DSBB        Location/Qualifiers
FT   CDS             complement(281083..281586)
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="ABO_0262"
FT                   /product="disulfide bond formation protein B"
FT                   /note="DsbB family protein identified by
FT                   sequencesimilarity; putative InterPro: Disulfide bond
FT                   formation protein DsbB"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15710"
FT                   /db_xref="GOA:Q0VSY8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSY8"
FT                   /protein_id="CAL15710.1"
FT                   /translation="MSSIIPAPRPLNALAFLACLAAIVGALYLQHVDGLEPCPLCIFQR
FT                   VGVIAGAVILLIASLHGPKNIGVRIYGALTTLAALGGGAVAARHIWLQNLPADQVPACG
FT                   PGLDYMLEVFPLQNVLQQVLAGSGECAEMDWSFLGLSLPGWSMVVFAGLLLVGLIQMFR
FT                   PLTR"
     MSSIIPAPRP LNALAFLACL AAIVGALYLQ HVDGLEPCPL CIFQRVGVIA GAVILLIASL        60
     HGPKNIGVRI YGALTTLAAL GGGAVAARHI WLQNLPADQV PACGPGLDYM LEVFPLQNVL       120
     QQVLAGSGEC AEMDWSFLGL SLPGWSMVVF AGLLLVGLIQ MFRPLTR                     167
//

If you have problems or comments...

PBIL Back to PBIL home page