(data stored in ACNUC7421 zone)

EMBL: AM286690.ECH1

AM286690.ECH1        Location/Qualifiers
FT   CDS             158544..159398
FT                   /transl_table=11
FT                   /gene="ech1"
FT                   /locus_tag="ABO_0148"
FT                   /product="enoyl-CoA hydratase/isomerase, putative"
FT                   /function="catalyze the reversible hydration of alpha,
FT                   beta-unsaturated enoyl-CoA substrates to the corresponding
FT                   beta-hydroxyacyl-CoA products"
FT                   /EC_number="4.2.1.17"
FT                   /note="(enoyl-CoA hydratase/isomerase family protein,
FT                   putative) identified by match to PFAM protein family
FT                   HMMPF00378 InterPro: Enoyl-CoA hydratase/isomerase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15596"
FT                   /db_xref="GOA:Q0VTC4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTC4"
FT                   /inference="protein motif:HMMPFAM:HMMPF00378"
FT                   /protein_id="CAL15596.1"
FT                   /translation="MSALPEYRSFDVTVQNFIAHVQFSRPESLNSMNKDFWLELPRCLR
FT                   DIEASTDARVVVISSTGKHFSAGMDLAVFSDPSGAPMGGDPGRMAENLRRVVLQLQDCL
FT                   SVLEQVRIPVLAAIQGGCIGGALDLVCAADSRYCTEDAFFTIKETPLGMTADVGTLQRL
FT                   PKLMPQGLVRELAYTGRKFGAQEAAEQGLVNSVYGNTHDMLAAVMGIAADIAANSPLAV
FT                   MGCKEMLNYSRDHSVEDSLKYMATWQAGMFRPDDMMLTFQAQAKKEQAQYPDLMPIKEL
FT                   FES"
     MSALPEYRSF DVTVQNFIAH VQFSRPESLN SMNKDFWLEL PRCLRDIEAS TDARVVVISS        60
     TGKHFSAGMD LAVFSDPSGA PMGGDPGRMA ENLRRVVLQL QDCLSVLEQV RIPVLAAIQG       120
     GCIGGALDLV CAADSRYCTE DAFFTIKETP LGMTADVGTL QRLPKLMPQG LVRELAYTGR       180
     KFGAQEAAEQ GLVNSVYGNT HDMLAAVMGI AADIAANSPL AVMGCKEMLN YSRDHSVEDS       240
     LKYMATWQAG MFRPDDMMLT FQAQAKKEQA QYPDLMPIKE LFES                        284
//

If you have problems or comments...

PBIL Back to PBIL home page