(data stored in ACNUC7421 zone)

EMBL: AM286690.ENVZ

AM286690.ENVZ        Location/Qualifiers
FT   CDS             292830..294149
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="ABO_0269"
FT                   /product="Osmolarity sensor protein EnvZ"
FT                   /function="Member of the two-component regulatory system
FT                   envZ/ompR involved in the regulation of osmoregulation
FT                   (genes ompF & ompC). EnvZ functions as a
FT                   membrane-associated protein kinase that phosphorylates ompR
FT                   in response to environmental signals."
FT                   /EC_number="2.7.3.-"
FT                   /note="(ompB), (perA), (tpo). Osmolarity sensor protein
FT                   EnvZ, protein histidine kinase/phosphatase sensor for OmpR,
FT                   modulatesexpression of ompF and ompC) identified by match
FT                   to PFAM protein family HMMPF02518 InterPro: Histidine
FT                   kinase C-terminal"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15717"
FT                   /db_xref="GOA:Q0VSY1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSY1"
FT                   /inference="protein motif:HMMPFAM:HMMPF02518"
FT                   /protein_id="CAL15717.1"
FT                   /translation="MTLYPRTAFVRSAVVVGLVIGISQALTLLFFARNAYLPGIREYAR
FT                   LTVLQAELTFDTPRALADQDLADRLGRASGITVAIPEELHDGIMLLSRPVVGRFQEELE
FT                   SMLEEPVTVRLGDSRQPVLWVNAPSFGKQWVRVPMAFFRDYDRYLLLGWGVTVPLLAII
FT                   GGLLIARGLNLPLRRLAKVALKVGRGEAVPVLDTTTGTEEIQAVNSAFNRMARDLQHAQ
FT                   RDRALLLAGVSHDLRTPLTRLRLSAEFMQDEELAKGIIEDIEDMDAILDQFISFIRDGA
FT                   DEQPDFENLNDLIQEVAGKYSPEQLRFELEDLPRLMLKRLTIKRMLANLVGNAFKYGAS
FT                   PVEVRTAVAENKVLLTVRDHGRGVREEDIPLLLQPFSRGEKARTLSGSGLGLAIVKRIV
FT                   DMHHGEIRLANHPHGGLLVEVRFPVTGKFVQPEPLSAGVR"
     MTLYPRTAFV RSAVVVGLVI GISQALTLLF FARNAYLPGI REYARLTVLQ AELTFDTPRA        60
     LADQDLADRL GRASGITVAI PEELHDGIML LSRPVVGRFQ EELESMLEEP VTVRLGDSRQ       120
     PVLWVNAPSF GKQWVRVPMA FFRDYDRYLL LGWGVTVPLL AIIGGLLIAR GLNLPLRRLA       180
     KVALKVGRGE AVPVLDTTTG TEEIQAVNSA FNRMARDLQH AQRDRALLLA GVSHDLRTPL       240
     TRLRLSAEFM QDEELAKGII EDIEDMDAIL DQFISFIRDG ADEQPDFENL NDLIQEVAGK       300
     YSPEQLRFEL EDLPRLMLKR LTIKRMLANL VGNAFKYGAS PVEVRTAVAE NKVLLTVRDH       360
     GRGVREEDIP LLLQPFSRGE KARTLSGSGL GLAIVKRIVD MHHGEIRLAN HPHGGLLVEV       420
     RFPVTGKFVQ PEPLSAGVR                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page