(data stored in ACNUC7421 zone)

EMBL: AM286690.FADA1

AM286690.FADA1       Location/Qualifiers
FT   CDS             271972..273138
FT                   /transl_table=11
FT                   /gene="fadA1"
FT                   /locus_tag="ABO_0253"
FT                   /product="acetyl-CoA acyltransferase"
FT                   /function="Formation of acetoacetyl-CoA from two molecules
FT                   of acetyl-CoA."
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by sequence similarity;"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15701"
FT                   /db_xref="GOA:Q0VSZ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSZ7"
FT                   /protein_id="CAL15701.1"
FT                   /translation="MAEAYIVAAVRTAGGKKNGRLSKVHPADMGGRVIDAVVERTGVAP
FT                   EKVDDVIFGCVSQIGPQAFNVARTSIMSSCLPESVPGVTIDRQCGSSQQAIHFAAQAVM
FT                   SGTQDLVIAGGVESMSQLPIGSPVLAAKELGNPFTGEISKRYPSATFSQFHGAERMAEK
FT                   YGVSKAELDQFAYDSHKRGAAATQAGRFSDEIIPVPVTLEDGSQEDHVVDEGIRWEAEL
FT                   DAIKALEPLQEGGHISAANASQITDGASAVMIASEAAVKELGLTPLARIHAMAVVGSDP
FT                   TMVLEGPIPATEKVLKQAGMSMADIDLYEVNEAFGSVPLAWMKAVGADYEKMNVNGGAQ
FT                   ALGHPLGATGSKLMGTLVYELKRRGGKYGLLTICEGLGTANATIIEAL"
     MAEAYIVAAV RTAGGKKNGR LSKVHPADMG GRVIDAVVER TGVAPEKVDD VIFGCVSQIG        60
     PQAFNVARTS IMSSCLPESV PGVTIDRQCG SSQQAIHFAA QAVMSGTQDL VIAGGVESMS       120
     QLPIGSPVLA AKELGNPFTG EISKRYPSAT FSQFHGAERM AEKYGVSKAE LDQFAYDSHK       180
     RGAAATQAGR FSDEIIPVPV TLEDGSQEDH VVDEGIRWEA ELDAIKALEP LQEGGHISAA       240
     NASQITDGAS AVMIASEAAV KELGLTPLAR IHAMAVVGSD PTMVLEGPIP ATEKVLKQAG       300
     MSMADIDLYE VNEAFGSVPL AWMKAVGADY EKMNVNGGAQ ALGHPLGATG SKLMGTLVYE       360
     LKRRGGKYGL LTICEGLGTA NATIIEAL                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page