(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSH

AM286690.FTSH        Location/Qualifiers
FT   CDS             352289..354205
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="ABO_0322"
FT                   /product="cell division protein FtsH"
FT                   /function="involved in the degradation of sigma-32.
FT                   degrades carboxy- terminal-tagged cytoplasmic proteins"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Peptidase family M41"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15770"
FT                   /db_xref="GOA:Q0VSS8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSS8"
FT                   /protein_id="CAL15770.1"
FT                   /translation="MNDMTKNVVLWLVIAGVLYVVASSLSTQPATADVPYSTFISRVEA
FT                   GKVQEAKIGESTITGTYTDGGQFRTVKPPTLDTNLMPTLIQNDVNVVGLEPQRQSFLTQ
FT                   LFLSVLPILLILAIFIFFMRQMQGGGRGGGGPMTFGKSKAKLLGEDQIKTTFADVAGVE
FT                   EAKEEVQELVEFLRDPAKFQRLGGKIPRGVLMVGSPGTGKTLLAKAIAGEAKVPFFSIS
FT                   GSDFVEMFVGVGASRVRDMFEQAKKHSPCIIFIDEIDAVGRSRGAGVGGGHDEREQTLN
FT                   QLLVEMDGFDGNEGIIVIAATNRPDVLDPALLRPGRFDRQVTVPLPDIRGREQVLKVHM
FT                   RQVPIADDVEPALIARGTPGFSGADLANLVNEAALFAARANKRMVSMEEFEKAKDKILM
FT                   GAERRSMVMNEKEKLNTAFHEAGHAIVGRLVPEHDPVYKVSIIPRGRALGVTMYLPEED
FT                   KYSQSKRGLESSICSLFGGRIAEEMTLGFDGVTTGASNDIERATKLARAMVTKWGLSEK
FT                   MGPLAYEEEEGEVFLGKQVGQRKHMSEQTAEEIDREVRAIIDNCYGRAKEILERNRDKL
FT                   ELMADALMQYETIDADQIEDIMSGHKPRPPKDWRDQGPGNGAAASGDSASGDDPIGGPA
FT                   NTH"
     MNDMTKNVVL WLVIAGVLYV VASSLSTQPA TADVPYSTFI SRVEAGKVQE AKIGESTITG        60
     TYTDGGQFRT VKPPTLDTNL MPTLIQNDVN VVGLEPQRQS FLTQLFLSVL PILLILAIFI       120
     FFMRQMQGGG RGGGGPMTFG KSKAKLLGED QIKTTFADVA GVEEAKEEVQ ELVEFLRDPA       180
     KFQRLGGKIP RGVLMVGSPG TGKTLLAKAI AGEAKVPFFS ISGSDFVEMF VGVGASRVRD       240
     MFEQAKKHSP CIIFIDEIDA VGRSRGAGVG GGHDEREQTL NQLLVEMDGF DGNEGIIVIA       300
     ATNRPDVLDP ALLRPGRFDR QVTVPLPDIR GREQVLKVHM RQVPIADDVE PALIARGTPG       360
     FSGADLANLV NEAALFAARA NKRMVSMEEF EKAKDKILMG AERRSMVMNE KEKLNTAFHE       420
     AGHAIVGRLV PEHDPVYKVS IIPRGRALGV TMYLPEEDKY SQSKRGLESS ICSLFGGRIA       480
     EEMTLGFDGV TTGASNDIER ATKLARAMVT KWGLSEKMGP LAYEEEEGEV FLGKQVGQRK       540
     HMSEQTAEEI DREVRAIIDN CYGRAKEILE RNRDKLELMA DALMQYETID ADQIEDIMSG       600
     HKPRPPKDWR DQGPGNGAAA SGDSASGDDP IGGPANTH                               638
//

If you have problems or comments...

PBIL Back to PBIL home page