(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSI

AM286690.FTSI        Location/Qualifiers
FT   CDS             647862..649583
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ABO_0592"
FT                   /product="penicillin-binding protein 3"
FT                   /function="responsible for the final stages of
FT                   peptidoglycan biosynthesis for cell wall formation"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Penicillin binding protein transpeptidase domain"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16040"
FT                   /db_xref="GOA:Q0VS08"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS08"
FT                   /protein_id="CAL16040.1"
FT                   /translation="MKKQARKIRQPNHLMRWRFVLGFWSVCACLLLIRAVDLQVIQHDF
FT                   LAHQGDIRNLRVEPLAAHRGVIRDRAGKPLAVSTPVVTLWVNPREAMEHQDQWGRLAGN
FT                   SVIDQKAFARKVRRHKSREFIYLERGLAPETAKTVLSLNVPGVYALTEYRRYYPAGEVA
FT                   SHVVGFTNIDDQGQEGIELALEDHLSGHSGRKKVVRDLLGRVIQDIEVLEPAEPGEDVT
FT                   LSIDLRLQYLAYRELLGAVQKFNAKGGSAVVLDVRTGEVLAMVNQPAYNPNNRGNLDTG
FT                   ALRNRAVTDLFEPGSTMKPFTVAAALEMGMVTPSTTINTHPGTLRVGSKTIRDHRDYGV
FT                   IDITTVLTKSSNVGTSKLALAMDSQALPGYLERFGFGQSTHIAFPGESDGLLPLRSKWR
FT                   DVERAALSYGYGLSVSAVQLAQAYAVIANDGVKVPLTLKKVDQPPQGEQVIGKATARQL
FT                   VQMLETVVSRVGTARRAQVPGYQVAGKTGTVHKVVNGGYADDNYIGLFAGLAPATDPRI
FT                   VTVVVIDDPAGDAYYGGLVAAPAFSRIMSGVLRSLHVPPDKPDGLLAGGPDGEDRS"
     MKKQARKIRQ PNHLMRWRFV LGFWSVCACL LLIRAVDLQV IQHDFLAHQG DIRNLRVEPL        60
     AAHRGVIRDR AGKPLAVSTP VVTLWVNPRE AMEHQDQWGR LAGNSVIDQK AFARKVRRHK       120
     SREFIYLERG LAPETAKTVL SLNVPGVYAL TEYRRYYPAG EVASHVVGFT NIDDQGQEGI       180
     ELALEDHLSG HSGRKKVVRD LLGRVIQDIE VLEPAEPGED VTLSIDLRLQ YLAYRELLGA       240
     VQKFNAKGGS AVVLDVRTGE VLAMVNQPAY NPNNRGNLDT GALRNRAVTD LFEPGSTMKP       300
     FTVAAALEMG MVTPSTTINT HPGTLRVGSK TIRDHRDYGV IDITTVLTKS SNVGTSKLAL       360
     AMDSQALPGY LERFGFGQST HIAFPGESDG LLPLRSKWRD VERAALSYGY GLSVSAVQLA       420
     QAYAVIANDG VKVPLTLKKV DQPPQGEQVI GKATARQLVQ MLETVVSRVG TARRAQVPGY       480
     QVAGKTGTVH KVVNGGYADD NYIGLFAGLA PATDPRIVTV VVIDDPAGDA YYGGLVAAPA       540
     FSRIMSGVLR SLHVPPDKPD GLLAGGPDGE DRS                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page