(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSW

AM286690.FTSW        Location/Qualifiers
FT   CDS             654830..655987
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ABO_0597"
FT                   /product="cell division protein FtsW"
FT                   /function="Bacterial cell division membrane protein"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF01098 InterPro: Cell cycle proteins"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16045"
FT                   /db_xref="GOA:Q0VS03"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS03"
FT                   /inference="protein motif:HMMPFAM:HMMPF01098"
FT                   /protein_id="CAL16045.1"
FT                   /translation="MTERMILKVDHTGIDKPLLWTAILLALAGLVMVSSASLQIAETRL
FT                   GDPFYYAMRHGIYLALGLGVGAFVYYAVPLALLERLRFVMLPVALVALVMVFIPGLGRT
FT                   VNGSTRWIALPGLTIQASEIVKLCFVLYLAGYVAQRKAALETEWKAFLLPLGLLGVLML
FT                   LLLLEPDFGAVVVLGITAMGMLFLSGVPTLRFLLIGLIAVALGGLVAFAEPYRVARLMT
FT                   FTDPWADQFGSGYQLTQSLIAFGRGHWFGVGLGNSVQKLFYLPEAHTDFVYAVMSEELG
FT                   LLGNVALIGGFILLGWRVFRIGHRLEARGLLYHAYLVYGCAFVFCSQAFINLGVNMGLL
FT                   PTKGLTLPFISYGGSSLLISAVMVGLILRAGAEADHLKARGRAAR"
     MTERMILKVD HTGIDKPLLW TAILLALAGL VMVSSASLQI AETRLGDPFY YAMRHGIYLA        60
     LGLGVGAFVY YAVPLALLER LRFVMLPVAL VALVMVFIPG LGRTVNGSTR WIALPGLTIQ       120
     ASEIVKLCFV LYLAGYVAQR KAALETEWKA FLLPLGLLGV LMLLLLLEPD FGAVVVLGIT       180
     AMGMLFLSGV PTLRFLLIGL IAVALGGLVA FAEPYRVARL MTFTDPWADQ FGSGYQLTQS       240
     LIAFGRGHWF GVGLGNSVQK LFYLPEAHTD FVYAVMSEEL GLLGNVALIG GFILLGWRVF       300
     RIGHRLEARG LLYHAYLVYG CAFVFCSQAF INLGVNMGLL PTKGLTLPFI SYGGSSLLIS       360
     AVMVGLILRA GAEADHLKAR GRAAR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page