(data stored in ACNUC7421 zone)

EMBL: AM286690.FUR

AM286690.FUR         Location/Qualifiers
FT   CDS             336676..337077
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="ABO_0309"
FT                   /product="transcriptional regulator Fur"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15757"
FT                   /db_xref="GOA:Q0VSU1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSU1"
FT                   /protein_id="CAL15757.1"
FT                   /translation="MDNQDLRKAGLKVTLPRVKILQQLEKSAERHLSAEDIYKSLMDSG
FT                   EDVGLATVYRVLTQFEQAGMVLRHNFEGGSAVFELADEEHHDHMVCMETGAVVEFMDDV
FT                   IESRQHAIAEEYGYEIVDHSLVLYVKPKK"
     MDNQDLRKAG LKVTLPRVKI LQQLEKSAER HLSAEDIYKS LMDSGEDVGL ATVYRVLTQF        60
     EQAGMVLRHN FEGGSAVFEL ADEEHHDHMV CMETGAVVEF MDDVIESRQH AIAEEYGYEI       120
     VDHSLVLYVK PKK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page