(data stored in ACNUC7421 zone)

EMBL: AM286690.FUSA

AM286690.FUSA        Location/Qualifiers
FT   CDS             428696..430795
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="ABO_0382"
FT                   /product="elongation factor (EF)"
FT                   /function="This protein promotes the GTP-dependent
FT                   translocation of the nascent protein chain from the a-site
FT                   to the p-site of the ribosome."
FT                   /EC_number="3.6.5.3"
FT                   /note=", (fus), (far) (translation elongation factor G),
FT                   (elongation factor G) identified by sequencesimilarity;
FT                   putative InterPro: Translation elongation factor G"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15830"
FT                   /db_xref="GOA:Q0VSL8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSL8"
FT                   /protein_id="CAL15830.1"
FT                   /translation="MARKTPLNRYRNIGICAHVDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWQGMDQQYDQHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQANKYEVPRIVFVNKMDRAGADFDSVCNQIRKRLG
FT                   ASVVPIQYNIGAEDNFKGVVDLIRMKAIFWNEEDMGMTYEEKDIPDDIKDRCDELREQM
FT                   TEAAAEGSEELMEKYLEEGDLSNDEIKAGLRQQVLANEIVLGLCGSAFKNKGVQALLDA
FT                   VIEFLPAPDEVKAIQGVLPDGETVEARKSSDDEPFSALAFKIATDPFVGSLTFIRVYSG
FT                   VLNSGDSVLNSVREKKERVGRLLQMHANSREEIKEVLAGDIAACVGMKDVTTGDTLCDL
FT                   KNPIVLERMEFPEPVISVAVEPKSKADQEKMGLALGRLAQEDPSFRVKTDEETGQTIIS
FT                   GMGELHLDILVDRMRREFKVEANIGAPQVAYRETFTRGADVDGKFVKQSGGRGQYGHVK
FT                   VKFEPIDRDEEFQFEEQIHGGSVPKEYFGAVQKGIDEQLQAGVLAGYPILGVKATLYDG
FT                   SYHEVDSNENAFRMAGALAVKNAAKEAGAVLLEPIMKVEAVTPEDYMGDVMGDLNRRRG
FT                   IVQGMEDTMAGKIIRAEVPLSEMFGYATDLRSMSQGRASYSMEFLKYAEAPKNIADEVI
FT                   SGKKS"
     MARKTPLNRY RNIGICAHVD AGKTTTTERI LFYTGVSHKI GEVHDGAATM DWMEQEQERG        60
     ITITSAATTT FWQGMDQQYD QHRINIIDTP GHVDFTIEVE RSLRVLDGAV VVFCGSSGVE       120
     PQSETVWRQA NKYEVPRIVF VNKMDRAGAD FDSVCNQIRK RLGASVVPIQ YNIGAEDNFK       180
     GVVDLIRMKA IFWNEEDMGM TYEEKDIPDD IKDRCDELRE QMTEAAAEGS EELMEKYLEE       240
     GDLSNDEIKA GLRQQVLANE IVLGLCGSAF KNKGVQALLD AVIEFLPAPD EVKAIQGVLP       300
     DGETVEARKS SDDEPFSALA FKIATDPFVG SLTFIRVYSG VLNSGDSVLN SVREKKERVG       360
     RLLQMHANSR EEIKEVLAGD IAACVGMKDV TTGDTLCDLK NPIVLERMEF PEPVISVAVE       420
     PKSKADQEKM GLALGRLAQE DPSFRVKTDE ETGQTIISGM GELHLDILVD RMRREFKVEA       480
     NIGAPQVAYR ETFTRGADVD GKFVKQSGGR GQYGHVKVKF EPIDRDEEFQ FEEQIHGGSV       540
     PKEYFGAVQK GIDEQLQAGV LAGYPILGVK ATLYDGSYHE VDSNENAFRM AGALAVKNAA       600
     KEAGAVLLEP IMKVEAVTPE DYMGDVMGDL NRRRGIVQGM EDTMAGKIIR AEVPLSEMFG       660
     YATDLRSMSQ GRASYSMEFL KYAEAPKNIA DEVISGKKS                              699
//

If you have problems or comments...

PBIL Back to PBIL home page