(data stored in ACNUC7421 zone)

EMBL: AM286690.GLYQ

AM286690.GLYQ        Location/Qualifiers
FT   CDS             complement(10270..11274)
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="ABO_0009"
FT                   /product="glycyl-tRNA synthetase"
FT                   /function="atp + glycine + trna(gly) = amp + diphosphate +
FT                   glycyl-trna(gly)"
FT                   /EC_number="6.1.1.14"
FT                   /note="(glycyl-tRNA synthetase tetrameric type
FT                   alphasubunit) identified by sequence similarity; putative
FT                   InterPro: Glycyl-tRNA synthetase alpha subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15457"
FT                   /db_xref="GOA:Q0VT22"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT22"
FT                   /protein_id="CAL15457.1"
FT                   /translation="MAEQPQTDILTFQGLILALQQYWAEQGCVVVQPLDMEVGAGTFHP
FT                   STFLRAIGPENWNSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGS
FT                   LRMLGFDPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCYPVT
FT                   GEITYGLERLAMYIQGVDSVYDLVWSDGPFGKVTYGDVFLQNEVEMSTFNFEHANVDEL
FT                   FKQFDLFEGESSKLIDAGLPLPAYEYVLKASHTFNLLDARKAISVTERQRFILRVRTLA
FT                   RAVAQAYFDKRRALGFPMADDTVREEVMAELQKQDDKAAKQAQKDGQKKKGKQ"
     MAEQPQTDIL TFQGLILALQ QYWAEQGCVV VQPLDMEVGA GTFHPSTFLR AIGPENWNSA        60
     YVQPSRRPTD GRYGENPNRL QHYYQFQVVL KPSPDNIQEL YLGSLRMLGF DPLVHDIRFV       120
     EDNWESPTLG AWGLGWEVWL NGMEVTQFTY FQQVGGIDCY PVTGEITYGL ERLAMYIQGV       180
     DSVYDLVWSD GPFGKVTYGD VFLQNEVEMS TFNFEHANVD ELFKQFDLFE GESSKLIDAG       240
     LPLPAYEYVL KASHTFNLLD ARKAISVTER QRFILRVRTL ARAVAQAYFD KRRALGFPMA       300
     DDTVREEVMA ELQKQDDKAA KQAQKDGQKK KGKQ                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page