(data stored in ACNUC7421 zone)

EMBL: AM286690.GMHA

AM286690.GMHA        Location/Qualifiers
FT   CDS             complement(640684..641271)
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="ABO_0584"
FT                   /product="phosphoheptose isomerase"
FT                   /function="involved in synthesis of glyceromannoheptose
FT                   7-phosphate (by similarity)."
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF01380 InterPro: Phosphoheptose isomerase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16032"
FT                   /db_xref="GOA:Q0VS16"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS16"
FT                   /inference="protein motif:HMMPFAM:HMMPF01380"
FT                   /protein_id="CAL16032.1"
FT                   /translation="MSVDRIRQLFAESIETKAKAGEVLPSVIEAAGQAMVECLLNGGKI
FT                   LTCGNGGSAGDAQHFSSELLNRFEMERPALPAIALTTDSSTLTSIANDYSYNEIFSKQI
FT                   RALGGSGDILLAISTSGNSANVIQAIQAAHDREMRVVAMTGKEGGEMVNLYGPNDIEIR
FT                   VPATSTARIQEVHLLVIHALCDYIDQQLFGGQ"
     MSVDRIRQLF AESIETKAKA GEVLPSVIEA AGQAMVECLL NGGKILTCGN GGSAGDAQHF        60
     SSELLNRFEM ERPALPAIAL TTDSSTLTSI ANDYSYNEIF SKQIRALGGS GDILLAISTS       120
     GNSANVIQAI QAAHDREMRV VAMTGKEGGE MVNLYGPNDI EIRVPATSTA RIQEVHLLVI       180
     HALCDYIDQQ LFGGQ                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page