(data stored in ACNUC7421 zone)

EMBL: AM286690.GMK-2

AM286690.GMK-2       Location/Qualifiers
FT   CDS             complement(187269..187892)
FT                   /transl_table=11
FT                   /gene="gmk-2"
FT                   /locus_tag="ABO_0178"
FT                   /product="guanylate kinase"
FT                   /function="catalyzes the ATP-dependent phosphorylation of
FT                   GMP into GDP"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Guanylate kinase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15626"
FT                   /db_xref="GOA:Q0VT94"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT94"
FT                   /protein_id="CAL15626.1"
FT                   /translation="MADKGTLYIISAPSGAGKTSLVAALVDKLAQVRISISHTTRAMRP
FT                   GEKDGVNYHFTDRDCFVRQVEQGRFLEHAQVFGNLYGTSADWVAQTLRTGDDVILEIDW
FT                   QGATQIRKQLPDSVSIFILPPSLEALAGRLRGRETDDETVIQQRLDGAQEEMSHYGEFD
FT                   YLVVNDDFQRALYELEAIVEARRLVTARQVARQAATLQNLLARR"
     MADKGTLYII SAPSGAGKTS LVAALVDKLA QVRISISHTT RAMRPGEKDG VNYHFTDRDC        60
     FVRQVEQGRF LEHAQVFGNL YGTSADWVAQ TLRTGDDVIL EIDWQGATQI RKQLPDSVSI       120
     FILPPSLEAL AGRLRGRETD DETVIQQRLD GAQEEMSHYG EFDYLVVNDD FQRALYELEA       180
     IVEARRLVTA RQVARQAATL QNLLARR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page