(data stored in ACNUC7421 zone)

EMBL: AM286690.GUAA

AM286690.GUAA        Location/Qualifiers
FT   CDS             52974..53705
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="ABO_0051"
FT                   /product="glutamine amidotransferase, class I (GATase)"
FT                   /function="removal of the ammonia group from a glutamate
FT                   molecule and its subsequent transfer to a specific
FT                   substrate, thus creating a new carbon-nitrogen group on the
FT                   substrate"
FT                   /EC_number="6.3.5.2"
FT                   /note="(glutamine amidotransferase class I) identified by
FT                   match to TIGR protein family HMMTIGR00888"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15499"
FT                   /db_xref="GOA:Q0VTG3"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTG3"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00888"
FT                   /protein_id="CAL15499.1"
FT                   /translation="MSSLKPIAIIQTGHTYPQIRQHYGDFDDWIAQGLGQLSPVIRVDA
FT                   IKEGPLPAPESLAGVVITGSHAMVTEAKPWMKKLAHWLFSTLENAQQLPVLGLCFGHQL
FT                   LAQVLGGEVADNPLGMQVGTVPLRFTAAGQQDALLGAMAGHPWAQVVHRQSVLTPPPGS
FT                   TVLASNVHDACQAFRYGERVWGVQFHPEFSADVMRSYLQRLSGEGLMQQQVDTHLQNVR
FT                   ECRDASAILARFAQLTLAQVA"
     MSSLKPIAII QTGHTYPQIR QHYGDFDDWI AQGLGQLSPV IRVDAIKEGP LPAPESLAGV        60
     VITGSHAMVT EAKPWMKKLA HWLFSTLENA QQLPVLGLCF GHQLLAQVLG GEVADNPLGM       120
     QVGTVPLRFT AAGQQDALLG AMAGHPWAQV VHRQSVLTPP PGSTVLASNV HDACQAFRYG       180
     ERVWGVQFHP EFSADVMRSY LQRLSGEGLM QQQVDTHLQN VRECRDASAI LARFAQLTLA       240
     QVA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page