(data stored in ACNUC7421 zone)

EMBL: AM286690.GYRB

AM286690.GYRB        Location/Qualifiers
FT   CDS             3785..6202
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ABO_0004"
FT                   /product="DNA gyrase, subunit B"
FT                   /function="DNA gyrase (topoisomerase II) B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: DNA topoisomerase II"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15452"
FT                   /db_xref="GOA:Q0VT27"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT27"
FT                   /protein_id="CAL15452.1"
FT                   /translation="MAEKKYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGFCSEIKVVIHPDESMSIQDNGRGIPTEMHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNTYKVSGGLHGVGVSVVNALSEELKLTIRRNGQVHEQIYNHGVPAKPLEVVGTTDS
FT                   SGTAVHFRPSPETFSNIKFHYDILAKRLRELSFLNSGVRIHLMDERSGDEDVFEYEGGL
FT                   SAFVSYLNTNKTPLNQVFHFNYEREEDGIAVEVAMQWNDSYQENIFCFTNNIPQRDGGT
FT                   HLAGFRAALTRTLNSYMDKEGFLKKEKASPSGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVEQTMGDLFQDYLLENPGEARSIVQKIIDAARARDAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQQKDPALSELYIVEGDSAGGSAKQGRDRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVGTLITALGCGIGRDEYNIEKLRYHRIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYVYIAQPPLYKVKKGKQETYLKDDPAMEEYLTTLALDKTGLYPGNDAPPI
FT                   SGEPLAKLIAEYRGVMKIVDRQSRVFPEEVLEQMIYMPSLSESSLNDEAAMMQWCETLG
FT                   KRVDAITDATQTFTITAQRDEERGLYLPRVQVLAHGVPREYKVTLDFLQSPDYQKIKAL
FT                   GETLEGLLAEDAYIQRGESQRPIRHFAEALDWLMAQARRGTSFQRYKGLGEMNADQLWE
FT                   TTMDPESRRMLQVTIEDAIAADQIFTCLMGDDVDPRRRFIESNALQVSNLDV"
     MAEKKYDSSS IKVLKGLDAV RKRPGMYIGD TDDGTGLHHM VFEVVDNSID EALAGFCSEI        60
     KVVIHPDESM SIQDNGRGIP TEMHEEEGVS AAEVIMTVLH AGGKFDDNTY KVSGGLHGVG       120
     VSVVNALSEE LKLTIRRNGQ VHEQIYNHGV PAKPLEVVGT TDSSGTAVHF RPSPETFSNI       180
     KFHYDILAKR LRELSFLNSG VRIHLMDERS GDEDVFEYEG GLSAFVSYLN TNKTPLNQVF       240
     HFNYEREEDG IAVEVAMQWN DSYQENIFCF TNNIPQRDGG THLAGFRAAL TRTLNSYMDK       300
     EGFLKKEKAS PSGDDAREGL TAVISVKVPD PKFSSQTKDK LVSSEVKSAV EQTMGDLFQD       360
     YLLENPGEAR SIVQKIIDAA RARDAARKAR EMTRRKGALD IAGLPGKLAD CQQKDPALSE       420
     LYIVEGDSAG GSAKQGRDRK NQAILPLKGK ILNVEKARFD KMLSSQEVGT LITALGCGIG       480
     RDEYNIEKLR YHRIIIMTDA DVDGSHIRTL LLTFFFRQLP ELIERGYVYI AQPPLYKVKK       540
     GKQETYLKDD PAMEEYLTTL ALDKTGLYPG NDAPPISGEP LAKLIAEYRG VMKIVDRQSR       600
     VFPEEVLEQM IYMPSLSESS LNDEAAMMQW CETLGKRVDA ITDATQTFTI TAQRDEERGL       660
     YLPRVQVLAH GVPREYKVTL DFLQSPDYQK IKALGETLEG LLAEDAYIQR GESQRPIRHF       720
     AEALDWLMAQ ARRGTSFQRY KGLGEMNADQ LWETTMDPES RRMLQVTIED AIAADQIFTC       780
     LMGDDVDPRR RFIESNALQV SNLDV                                             805
//

If you have problems or comments...

PBIL Back to PBIL home page