(data stored in ACNUC7421 zone)

EMBL: AM286690.HYDG

AM286690.HYDG        Location/Qualifiers
FT   CDS             complement(375407..376735)
FT                   /transl_table=11
FT                   /gene="hydG"
FT                   /locus_tag="ABO_0341"
FT                   /product="nitrogen regulation protein NR(I"
FT                   /function="Response regulator containing CheY"
FT                   /note=") identified by match to PFAM protein family
FT                   HMMPF00072 InterPro: Sigma-54 factor interaction domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15789"
FT                   /db_xref="GOA:Q0VSQ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ9"
FT                   /inference="protein motif:HMMPFAM:HMMPF00072"
FT                   /protein_id="CAL15789.1"
FT                   /translation="MSHILIVEDEPVIRGALRKLLVRHEHSVEEAESVEQALENNLNQF
FT                   DLIISDLRLPGEPGTNLIEAAGNTPVLIMTSYASLRSAVDAMRLGAVDYIPKPFDHDEM
FT                   LLAVDRVLKEGRLNRGNRALRRDLERSFPVRNMVGDSPAMQELKHRISRVAPTNTPVLI
FT                   MGEAGTGKELTARALHEHSKRINGPLVSIQCAALPKNLQLTELFGDDEQPGRIEEADGG
FT                   TLFLDEVGELASDVQSRLLTLLTHHEIHRQGSLSPRRVDVRILASNQLDLPNRITDGSF
FT                   RQDLYYRLNVMELTLPPLRDRHEDLEPLANALLARGSEKLNRPNLHFTPQALGAMHSYS
FT                   WPGNVRELENVIERAIILTEEDGIGPAQLGLNPSRPPQRVSRASLDPSEDLSLEDYFTR
FT                   FVMENQDSMTETELAQKLGISRKSLWERRQRLGIPRKKSSIRR"
     MSHILIVEDE PVIRGALRKL LVRHEHSVEE AESVEQALEN NLNQFDLIIS DLRLPGEPGT        60
     NLIEAAGNTP VLIMTSYASL RSAVDAMRLG AVDYIPKPFD HDEMLLAVDR VLKEGRLNRG       120
     NRALRRDLER SFPVRNMVGD SPAMQELKHR ISRVAPTNTP VLIMGEAGTG KELTARALHE       180
     HSKRINGPLV SIQCAALPKN LQLTELFGDD EQPGRIEEAD GGTLFLDEVG ELASDVQSRL       240
     LTLLTHHEIH RQGSLSPRRV DVRILASNQL DLPNRITDGS FRQDLYYRLN VMELTLPPLR       300
     DRHEDLEPLA NALLARGSEK LNRPNLHFTP QALGAMHSYS WPGNVRELEN VIERAIILTE       360
     EDGIGPAQLG LNPSRPPQRV SRASLDPSED LSLEDYFTRF VMENQDSMTE TELAQKLGIS       420
     RKSLWERRQR LGIPRKKSSI RR                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page