(data stored in ACNUC7421 zone)

EMBL: AM286690.ICD

AM286690.ICD         Location/Qualifiers
FT   CDS             complement(322684..323700)
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="ABO_0296"
FT                   /product="isocitrate dehydrogenase"
FT                   /function="isocitrate + NADP(+) = 2-oxoglutarate + CO(2) +
FT                   NADPH."
FT                   /EC_number="1.1.1.41"
FT                   /note="(isocitrate dehydrogenase NADP-dependent,
FT                   oxalosuccinate decarboxylase) identified by sequence
FT                   similarity; putative identified by match to PFAM protein
FT                   family HMMPF00180 and TIGRFAM protein family HMMTIGR00175
FT                   InterPro: Isocitrate and isopropylmalate dehydrogenases"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15744"
FT                   /db_xref="GOA:Q0VSV4"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV4"
FT                   /inference="protein motif:HMMPFAM:HMMPF00180"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00175"
FT                   /protein_id="CAL15744.1"
FT                   /translation="MNENTVTVIPGDGIGPDIVDSTVRVLDALDCGLKFEYAIAGQTAL
FT                   DKGLELVPEETLTILRRNRLALKGPITTPVGGGFTSVNVTLRKTFDLFANVRPALSIPG
FT                   VKSRYDNVDIMTIRENIEGIYSGLGQTVSDDGETAELRSRITRTESERLLRFAYETATK
FT                   QGRKKVTVVHKANIMKSTSGLFLDVARKVRKDYPNLEHEEMIVDACAMQLAMNPHRFDV
FT                   LVTTNLFGDILSDLCAGLIGGLGVAPGANIGEHGGLFEAVHGSAPDIAGKGIANPTAIL
FT                   LAGAMMLDYMEQHDKAKKLRRTVRHVVGQGEVVTPDLGGRASTSEFTDELIRHLTNQ"
     MNENTVTVIP GDGIGPDIVD STVRVLDALD CGLKFEYAIA GQTALDKGLE LVPEETLTIL        60
     RRNRLALKGP ITTPVGGGFT SVNVTLRKTF DLFANVRPAL SIPGVKSRYD NVDIMTIREN       120
     IEGIYSGLGQ TVSDDGETAE LRSRITRTES ERLLRFAYET ATKQGRKKVT VVHKANIMKS       180
     TSGLFLDVAR KVRKDYPNLE HEEMIVDACA MQLAMNPHRF DVLVTTNLFG DILSDLCAGL       240
     IGGLGVAPGA NIGEHGGLFE AVHGSAPDIA GKGIANPTAI LLAGAMMLDY MEQHDKAKKL       300
     RRTVRHVVGQ GEVVTPDLGG RASTSEFTDE LIRHLTNQ                               338
//

If you have problems or comments...

PBIL Back to PBIL home page