(data stored in ACNUC7421 zone)

EMBL: AM286690.ILVD-1

AM286690.ILVD-1      Location/Qualifiers
FT   CDS             189002..190687
FT                   /transl_table=11
FT                   /gene="ilvD-1"
FT                   /locus_tag="ABO_0180"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /function="2,3-dihydroxy-3-methylbutanoate =
FT                   3-methyl-2-oxobutanoate + H(2)O."
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by sequence similarity; putative
FT                   identified by match to PFAM protein family HMMPF00920
FT                   InterPro: Dihydroxy-acid dehydratase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15628"
FT                   /db_xref="GOA:Q0VT92"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT92"
FT                   /inference="protein motif:HMMPFAM:HMMPF00920"
FT                   /protein_id="CAL15628.1"
FT                   /translation="MSDSKGDPRRRHSAKVVDGPGKSASRAMLRAVGFTDEDFHKPQVG
FT                   IASTWSQVTPCNSHIGELAEKACAGADAAGGKGVIFNTITISDGIANGTEGMKYSLVSR
FT                   EVIADSIETVAACEGFDGLVALGGCDKNMPGCLMGMARLNRPSVFVYGGTIMPGKGHTD
FT                   IVSVFEAMGAHSRGDMDKIELKQIEETAIPGPGACGGMYTANTMASAIEALGMSLPGSS
FT                   AQNAVSEEKRDDCQRAGEAVLALLEQDIKPSDIMTRAAFENAITVVIALGGSTNAVLHL
FT                   IAMARTVGVPLSLDDFTEIGRRVPVLADLRPSGHYMMSELVAIGGIQPLMKVLLEAGLL
FT                   QGDCLTVTGRTLAENLADVSPYPLDQTIIAPLSAPLKAESHLRILYGNLAPDGAVAKIT
FT                   GKEGTHFSGPARVFGSEEEAQQRINDGTVVSGDVVVIRYEGPRGGPGMREMLTPTSAIM
FT                   GRGLGDEVALITDGRFSGGSHGFVVGHVTPEAFDGGPLALLENGDQITIDAEANTLVVA
FT                   LSDAELARRRANWQQPAPRYTRGVLAKYARLVGSASEGALTDLG"
     MSDSKGDPRR RHSAKVVDGP GKSASRAMLR AVGFTDEDFH KPQVGIASTW SQVTPCNSHI        60
     GELAEKACAG ADAAGGKGVI FNTITISDGI ANGTEGMKYS LVSREVIADS IETVAACEGF       120
     DGLVALGGCD KNMPGCLMGM ARLNRPSVFV YGGTIMPGKG HTDIVSVFEA MGAHSRGDMD       180
     KIELKQIEET AIPGPGACGG MYTANTMASA IEALGMSLPG SSAQNAVSEE KRDDCQRAGE       240
     AVLALLEQDI KPSDIMTRAA FENAITVVIA LGGSTNAVLH LIAMARTVGV PLSLDDFTEI       300
     GRRVPVLADL RPSGHYMMSE LVAIGGIQPL MKVLLEAGLL QGDCLTVTGR TLAENLADVS       360
     PYPLDQTIIA PLSAPLKAES HLRILYGNLA PDGAVAKITG KEGTHFSGPA RVFGSEEEAQ       420
     QRINDGTVVS GDVVVIRYEG PRGGPGMREM LTPTSAIMGR GLGDEVALIT DGRFSGGSHG       480
     FVVGHVTPEA FDGGPLALLE NGDQITIDAE ANTLVVALSD AELARRRANW QQPAPRYTRG       540
     VLAKYARLVG SASEGALTDL G                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page