(data stored in ACNUC7421 zone)

EMBL: AM286690.ISPE

AM286690.ISPE        Location/Qualifiers
FT   CDS             complement(570311..571216)
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="ABO_0519"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /function="catalyzes the phosphorylation of the position 2
FT                   hydroxy group of 4-diphosphocytidyl-2c-methyl-d-erythritol
FT                   (by similarity). atp + 4-(cytidine
FT                   5'-diphospho)-2-c-methyl-d- erythritol = adp +
FT                   2-phospho-4-(cytidine 5'-diphospho)-2-c-methyl-
FT                   d-erythritol."
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF00288 InterPro:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15967"
FT                   /db_xref="GOA:Q0VS81"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS81"
FT                   /inference="protein motif:HMMPFAM:HMMPF00288"
FT                   /protein_id="CAL15967.1"
FT                   /translation="MTLTLPAPAKLNLFLHITGRRDDGYHQLQTVFALLDHGDTLRFSP
FT                   ADTLSLQCHQEGGASDLPTDDSNLILQAARALQAHTGSSKGAAITLTKRLPMGGGVGGG
FT                   SSDAATALLGLNAFWALGLTLQELAHIGLTLGADVPVFVFGKSAWAEGVGEKINPIILP
FT                   NDAFLVVHPGIHVSTARIFGDQQLTRDTPISKLPASLETVLTREFHNDCEAVATQHFPE
FT                   IGKTLDWLKQHTGNARMTGTGACCFSRLTGLQQGQQLLQQLPQHWTGFVARSCNTSPLH
FT                   QILGEALAKFRETKNSGKPA"
     MTLTLPAPAK LNLFLHITGR RDDGYHQLQT VFALLDHGDT LRFSPADTLS LQCHQEGGAS        60
     DLPTDDSNLI LQAARALQAH TGSSKGAAIT LTKRLPMGGG VGGGSSDAAT ALLGLNAFWA       120
     LGLTLQELAH IGLTLGADVP VFVFGKSAWA EGVGEKINPI ILPNDAFLVV HPGIHVSTAR       180
     IFGDQQLTRD TPISKLPASL ETVLTREFHN DCEAVATQHF PEIGKTLDWL KQHTGNARMT       240
     GTGACCFSRL TGLQQGQQLL QQLPQHWTGF VARSCNTSPL HQILGEALAK FRETKNSGKP       300
     A                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page