(data stored in ACNUC7421 zone)

EMBL: AM286690.KPSF

AM286690.KPSF        Location/Qualifiers
FT   CDS             complement(614811..615779)
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="ABO_0557"
FT                   /product="KpsF/GutQ family protein"
FT                   /note="KpsF/GutQ family protein identified by match to PFAM
FT                   protein family HMMPF01380 InterPro: KpsF/GutQ family
FT                   protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16005"
FT                   /db_xref="GOA:Q0VS43"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS43"
FT                   /inference="protein motif:HMMPFAM:HMMPF01380"
FT                   /protein_id="CAL16005.1"
FT                   /translation="MSHNHISVGQRVLEIEARAVDALKDSLDTSFCAACDLMLNAKGRV
FT                   IVTGMGKSGHVGSKLAATLASTGTPSFFVHPGEASHGDLGMITADDVVLALSNSGETAE
FT                   VLAILPVIKRKGTALVGMTGRPQSALAQLSDVHLTVAVAEEACPHNLAPTSSTTAALAM
FT                   GDALAIALLEARGFTPEDFALSHPGGSLGRRLLLKVDDIMHTGEQLPVVSTTTSLSEAL
FT                   LEMTHKGLGMTAITHTDGTLAGIFTDGDLRRILDRDIDIRKATIAEVMVSDPITIAQGH
FT                   LAAEALQIMENRKINGLMVCDSDGKPLGAFNMQDLLRAGVV"
     MSHNHISVGQ RVLEIEARAV DALKDSLDTS FCAACDLMLN AKGRVIVTGM GKSGHVGSKL        60
     AATLASTGTP SFFVHPGEAS HGDLGMITAD DVVLALSNSG ETAEVLAILP VIKRKGTALV       120
     GMTGRPQSAL AQLSDVHLTV AVAEEACPHN LAPTSSTTAA LAMGDALAIA LLEARGFTPE       180
     DFALSHPGGS LGRRLLLKVD DIMHTGEQLP VVSTTTSLSE ALLEMTHKGL GMTAITHTDG       240
     TLAGIFTDGD LRRILDRDID IRKATIAEVM VSDPITIAQG HLAAEALQIM ENRKINGLMV       300
     CDSDGKPLGA FNMQDLLRAG VV                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page