(data stored in ACNUC7421 zone)

EMBL: AM286690.LYTB

AM286690.LYTB        Location/Qualifiers
FT   CDS             502784..503719
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="ABO_0462"
FT                   /product="LytB protein"
FT                   /function="catalyses the conversion of
FT                   1-hydroy-2-methyl-2-(E)-butenyl 4-diphosphate into IPP
FT                   (isopentenyl diphosphate) and DMAPP (dimethylallyl
FT                   diphosphate)"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00216 InterPro: LytB protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15910"
FT                   /db_xref="GOA:Q0VSD8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSD8"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00216"
FT                   /protein_id="CAL15910.1"
FT                   /translation="MQIRLANPRGFCAGVDRAIDIVNRALEVFGPPIHVRHEVVHNRYV
FT                   VEDLRQRGAVFVEELHEVPDDAIVIFSAHGVSKAVQEEAKRRQLQVFDATCPLVTKVHM
FT                   EVIRYAREGRESILIGHAGHPEVEGTMGQYDKSYGGDIYLVEDEADVVALTVRDESKLA
FT                   FVTQTTLSVDDTARVIDALRQRFPAIIGPKREDICYATTNRQDAVRQLALECGLVLVVG
FT                   SVNSSNSNRLRELAERCGAEAYLIDEPSQIEASWLKGKAAVGVTAGASAPEDLVQQVIA
FT                   TLKNLGGEDAEEIPGREENIRFSMPKALRP"
     MQIRLANPRG FCAGVDRAID IVNRALEVFG PPIHVRHEVV HNRYVVEDLR QRGAVFVEEL        60
     HEVPDDAIVI FSAHGVSKAV QEEAKRRQLQ VFDATCPLVT KVHMEVIRYA REGRESILIG       120
     HAGHPEVEGT MGQYDKSYGG DIYLVEDEAD VVALTVRDES KLAFVTQTTL SVDDTARVID       180
     ALRQRFPAII GPKREDICYA TTNRQDAVRQ LALECGLVLV VGSVNSSNSN RLRELAERCG       240
     AEAYLIDEPS QIEASWLKGK AAVGVTAGAS APEDLVQQVI ATLKNLGGED AEEIPGREEN       300
     IRFSMPKALR P                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page