(data stored in ACNUC7421 zone)

EMBL: AM286690.MAF-1

AM286690.MAF-1       Location/Qualifiers
FT   CDS             585647..586228
FT                   /transl_table=11
FT                   /gene="maf-1"
FT                   /locus_tag="ABO_0533"
FT                   /product="maf protein"
FT                   /function="putative inhibitor of septum formation"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00172 InterPro: Maf-like protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15981"
FT                   /db_xref="GOA:Q0VS67"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS67"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00172"
FT                   /protein_id="CAL15981.1"
FT                   /translation="MILYLASGSPRRAELLQQIAVPFTVLPAPSIDETPRSAEAAVDYV
FT                   RRMAREKALVGQARMPTPGAVLGADTAVVLGDQILGKPADDTEALAMLTQLSGTSHQVI
FT                   SAVCVCSEGRQAVRHTVTTVQFRPFEAARLEVYVATGEGRDKAGSYGIQGLGGALVESL
FT                   SGSYSGVVGLPLEQTVELLEWADIPYWQID"
     MILYLASGSP RRAELLQQIA VPFTVLPAPS IDETPRSAEA AVDYVRRMAR EKALVGQARM        60
     PTPGAVLGAD TAVVLGDQIL GKPADDTEAL AMLTQLSGTS HQVISAVCVC SEGRQAVRHT       120
     VTTVQFRPFE AARLEVYVAT GEGRDKAGSY GIQGLGGALV ESLSGSYSGV VGLPLEQTVE       180
     LLEWADIPYW QID                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page