(data stored in ACNUC7421 zone)

EMBL: AM286690.MMSA

AM286690.MMSA        Location/Qualifiers
FT   CDS             22278..23777
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="ABO_0020"
FT                   /product="methylmalonate semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /function="2-methyl-3-oxopropanoate + coa + nad(+) =
FT                   propanoyl-coa + co(2) + nadh"
FT                   /EC_number="1.2.1.27"
FT                   /note="(methylmalonate semialdehyde dehydrogenase)
FT                   identified by sequence similarity; putative InterPro:
FT                   Aldehyde dehydrogenase family distal valine metabolic
FT                   pathway"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15468"
FT                   /db_xref="GOA:Q0VT11"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT11"
FT                   /protein_id="CAL15468.1"
FT                   /translation="MAHQLPLLINGEFVASQTDQWIAVTNPATQQTLCEAPAATAEEME
FT                   QAIAAGKAAFQTWKEVPVSERARLMLRYQALLKEHHDEIAEILSQETGKTFEDAKGDVW
FT                   RGIEVAEQAANIASLMMGETVENVARSIDTHSWTQPLGVCAGITPFNFPAMIPLWMFPL
FT                   AIAAGNTFVLKPSEQDPMTPNRLAELFQEAGAAPGLLQVVHGGKEQVDTLLRHPDIKAV
FT                   SFVGSVPVGQHVYRTATDNMKRAQCFAGAKNHMVIMPDANKEQVVSSLVGSSCGAAGQR
FT                   CMAISVAVFVGDSKAWIDELASQFAQIRPGAWNDPEAAYGPQISPAAKQRVLSMIEQGK
FT                   KEGATCLLDGSDCTVEGLPDGNWVGPTLFTDVTTDMAIYREEIFGPVLCCVCVDSLEEA
FT                   LELVNSSPYGNGTSIFTANGAAARKYQHQVEVGQVGINVPIPVPLPFFSFTGWKGSFYG
FT                   DQHAYGKQGVRFYTETKTVTSRWFDSDIPVAAGPNMSINLK"
     MAHQLPLLIN GEFVASQTDQ WIAVTNPATQ QTLCEAPAAT AEEMEQAIAA GKAAFQTWKE        60
     VPVSERARLM LRYQALLKEH HDEIAEILSQ ETGKTFEDAK GDVWRGIEVA EQAANIASLM       120
     MGETVENVAR SIDTHSWTQP LGVCAGITPF NFPAMIPLWM FPLAIAAGNT FVLKPSEQDP       180
     MTPNRLAELF QEAGAAPGLL QVVHGGKEQV DTLLRHPDIK AVSFVGSVPV GQHVYRTATD       240
     NMKRAQCFAG AKNHMVIMPD ANKEQVVSSL VGSSCGAAGQ RCMAISVAVF VGDSKAWIDE       300
     LASQFAQIRP GAWNDPEAAY GPQISPAAKQ RVLSMIEQGK KEGATCLLDG SDCTVEGLPD       360
     GNWVGPTLFT DVTTDMAIYR EEIFGPVLCC VCVDSLEEAL ELVNSSPYGN GTSIFTANGA       420
     AARKYQHQVE VGQVGINVPI PVPLPFFSFT GWKGSFYGDQ HAYGKQGVRF YTETKTVTSR       480
     WFDSDIPVAA GPNMSINLK                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page