(data stored in ACNUC7421 zone)

EMBL: AM286690.MOEB

AM286690.MOEB        Location/Qualifiers
FT   CDS             577090..577833
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="ABO_0525"
FT                   /product="molybdopterin biosynthesis MoeB protein"
FT                   /EC_number="2.7.7.-"
FT                   /note="molybdopterin biosynthesis MoeB proteinputative
FT                   identified by sequencesimilarity; putative InterPro:
FT                   UBA/THIF-type NAD/FAD binding fold"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15973"
FT                   /db_xref="GOA:Q0VS75"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS75"
FT                   /protein_id="CAL15973.1"
FT                   /translation="MLNDDQLLRYSRQLMVEEFDLPGQEALSKARILVVGCGGLANPAA
FT                   LYLAGAGVGQLVLADDDRVELSNLHRQVAFRGDQLNQAKAEALRDQLQLLNADVDIRSA
FT                   VVRVDDAWLNEAVADATLVLDCTDNFSTRQAINRACVAHRTPLVSGAAIRMDGQLAVFD
FT                   LRTEDSPCYACVYGEGSEGDLACSEAGILGPVVGMVGTLQALAAIRTLTGTSVASVLHL
FT                   FDGRTLSWRQVAIPRDPECPVCAMN"
     MLNDDQLLRY SRQLMVEEFD LPGQEALSKA RILVVGCGGL ANPAALYLAG AGVGQLVLAD        60
     DDRVELSNLH RQVAFRGDQL NQAKAEALRD QLQLLNADVD IRSAVVRVDD AWLNEAVADA       120
     TLVLDCTDNF STRQAINRAC VAHRTPLVSG AAIRMDGQLA VFDLRTEDSP CYACVYGEGS       180
     EGDLACSEAG ILGPVVGMVG TLQALAAIRT LTGTSVASVL HLFDGRTLSW RQVAIPRDPE       240
     CPVCAMN                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page